KEGG   Mus musculus (house mouse): 12388
Entry
12388             CDS       T01002                                 
Symbol
Ctnnd1, AA409437, AU019353, Catns, Ctnnd, P120, mKIAA0384
Name
(RefSeq) catenin (cadherin associated protein), delta 1
  KO
K05690  catenin (cadherin-associated protein), delta 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04520  Adherens junction
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    12388 (Ctnnd1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    12388 (Ctnnd1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12388 (Ctnnd1)
SSDB
Motif
Pfam: Arm HEAT_2 Cnd1 Ebp2 Atx10homo_assoc HYPK_UBA
Other DBs
NCBI-GeneID: 12388
NCBI-ProteinID: NP_001078919
MGI: 105100
Ensembl: ENSMUSG00000034101
UniProt: P30999
Position
2:complement(84417440..84489321)
AA seq 938 aa
MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANSLMANGTL
TRRHQNGRFVGDADLERQKFSDLKLNGPQDHNHLLYSTIPRMQEPGQIVETYTEEDPEGA
MSVVSVETTDDGTTRRTETTVKKVVKTMTTRTVQPVPMGPDGLPVDASAVSNNYIQTLGR
DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYGRHYEDGYPGGSDNYGSLSRVTRIEER
YRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMS
DYGTARRTGTPSDPRRRLRSYEDMIGEEVPPDQYYWAPLAQHERGSLASLDSLRKGMPPP
SNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPILVGLLDHP
KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLS
SHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE
RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERY
QEALPTVANSTGPHAASCFGAKKGKDEWFSRGKKPTEDPANDTVDFPKRTSPARGYELLF
QPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIAELLT
SEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVVSILN
TINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE
KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIPMSNMGSNTKSL
DNNYSTLNERGDHNRTLDRSGDLGDMEPLKGAPLMQKI
NT seq 2817 nt   +upstreamnt  +downstreamnt
atggacgactcagaggtggagtcgaccgccagcatcttggcctctgtgaaagaacaagag
gcccagtttgagaagctgacccgggcgctggaagaggagcggcgccatgtctcggcgcaa
ctggaacgcgtccgggtctcaccacaagatgccaactcactcatggccaatggcaccctc
actcgtcggcatcagaacggccggtttgtgggcgatgctgaccttgagagacagaaattt
tcagatctgaaactcaacggaccccaggatcacaaccaccttctgtacagcactatcccc
aggatgcaggagccaggacagattgtggaaacctacaccgaggaggaccctgaaggagcc
atgtctgttgtttctgtggagaccacagatgatgggaccactagacgcacggagaccaca
gtcaaaaaagttgtgaagacaatgacaactcggacagtacagcctgtccccatggggcca
gacgggctgcccgtggacgcctcagcagtctccaataactatatccagaccttgggccgt
gattttcgcaagaatggcaatgggggccctggtccctatgtggggcaagcgggcactgcc
actcttcctaggaacttccactatcctccagatgggtatggccgacactatgaagatggt
tatccaggtggcagtgacaactacggcagtctgtcccgggtgacccgaattgaggagcgg
tataggcccagcatggaaggctaccgggcacccagtagacaagatgtctatgggccccag
ccccaggttcgagtaggtggaagcagtgtggacctgcatcgttttcatcctgagccttac
gggctagaggatgaccagcgcagcatgggctatgatgacctcgattacggcatgatgtct
gattatggtactgcccgtcggacaggaacaccctctgaccctcgacgacgcctcaggagc
tatgaagacatgattggtgaagaggtgccgcctgatcagtactattgggctcctttagct
cagcatgagcggggcagtttagcaagcttggatagtttgcgaaagggaatgcccccacct
tcaaactggagacagcctgagctgccagaggtgattgccatgttaggcttccgcttggat
gctgttaagtccaatgcagctgcatacctgcagcacttatgctaccgcaatgacaaggtg
aagactgacgtgcggaagctcaagggtatcccgatattggtaggattgttagaccatccc
aaaaaggaagtgcacctcggagcctgtggagctctcaagaatatctcttttggacgtgac
caagataacaagatcgccataaaaaactgtgatggtgttcctgctctggtccgattgctc
cgaaaggctcgtgatatggacctgactgaagtgattactggaaccctgtggaatctctca
tcccatgattcaatcaaaatggagattgtggaccatgcgctacatgccttgacagatgaa
gttatcattccacattctggttgggagagagaacctaatgaagactgtaagccacggcat
attgaatgggagtcagtgcttaccaacactgctggctgccttcggaacgtaagctcagag
aggagtgaagcccggaggaaacttcgggaatgtgacggcttagttgatgccctcattttc
atcgttcaggcagaaattgggcagaaggattcagacagtaagcttgtggagaattgtgtt
tgcctcctccggaacttatcataccaagttcatcgtgaaatcccacaggcagagcgttac
caggaggcccttcctactgtggctaacagtactgggccacacgctgccagttgctttgga
gccaagaagggcaaagatgagtggttctccagagggaaaaagcctacagaggatccagca
aatgatacagtggatttccctaaaagaactagtcctgctcgaggctatgaactcttattt
cagccagaagtggtgcgaatatacatttcactccttaaggagagcaagacgcctgccatc
ttagaagcctcggccggagctatccagaacttgtgtgctgggcgttggacatatggcaga
tacatccgctctgctcttcgtcaggagaaggctctctctgccatagctgagctccttacg
agtgagcatgagcgagtagtaaaagctgcttctggggcactgagaaatctggctgtggat
gctcggaacaaagagttaattggcaagcatgctattcctaacttggtaaagaatctgcca
ggaggtcaacagaactcctcctggaatttttctgaagatactgtggtctccatattgaac
accatcaacgaagttatcgctgagaacttagaagctgccaaaaagcttcgagagacgcag
ggtattgagaagctggtgttgatcaacaaatcagggaatcgttcagaaaaagaagtccgg
gcagcagctcttgtcctgcagacaatctggggctataaggagcttcggaagccactggaa
aaagaaggatggaagaaatcagacttccaggtgaatctaaacaatgcatctagaagccag
agcagccattcatatgatgatagcactctccccctcattgaccggaatcaaaaatcagat
aagaaacctgaccgggaagaaattccaatgagcaatatggggtcaaacacaaaatcatta
gataacaactattccacactgaatgagagaggagaccacaacagaacactggaccgatct
ggggatctgggtgatatggaaccattgaagggagcacccttgatgcagaagatttag

DBGET integrated database retrieval system