KEGG   Mus musculus (mouse): 12389
Entry
12389             CDS       T01002                                 

Gene name
Cav1, Cav, Cav-1, cave
Definition
(RefSeq) caveolin 1, caveolae protein
  KO
K06278  caveolin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04510  Focal adhesion
mmu05020  Prion disease
mmu05100  Bacterial invasion of epithelial cells
mmu05205  Proteoglycans in cancer
mmu05416  Viral myocarditis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12389 (Cav1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12389 (Cav1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    12389 (Cav1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12389 (Cav1)
  09164 Neurodegenerative disease
   05020 Prion disease
    12389 (Cav1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12389 (Cav1)
   05416 Viral myocarditis
    12389 (Cav1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12389 (Cav1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    12389 (Cav1)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 12389
NCBI-ProteinID: NP_031642
MGI: 102709
Ensembl: ENSMUSG00000007655
Vega: OTTMUSG00000024023
UniProt: P49817
Position
6; 6 A2
AA seq 178 aa
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactccgagggacatctctacactgttcccatccgggaa
cagggcaacatctacaagcccaacaacaaggccatggcagacgaggtgactgagaagcaa
gtgtatgacgcgcacaccaaggagattgacctggtcaaccgcgaccccaagcatctcaac
gacgacgtggtcaagattgactttgaagatgtgattgcagaaccagaagggacacacagt
ttcgacggcatctggaaggccagcttcaccaccttcactgtgacaaaatattggttttac
cgcttgttgtctacgatcttcggcatcccaatggcactcatctggggcatttactttgcc
attctctccttcctgcacatctgggcggttgtaccgtgcatcaagagcttcctgattgag
attcagtgcatcagccgcgtctactccatctacgtccataccttctgcgatccactcttt
gaagctattggcaagatattcagcaacatccgcatcagcacgcagaaagagatatga

KEGG   Mus musculus (mouse): 12390
Entry
12390             CDS       T01002                                 

Gene name
Cav2, AI447843
Definition
(RefSeq) caveolin 2
  KO
K12958  caveolin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04510  Focal adhesion
mmu05020  Prion disease
mmu05100  Bacterial invasion of epithelial cells
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12390 (Cav2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12390 (Cav2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    12390 (Cav2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12390 (Cav2)
  09164 Neurodegenerative disease
   05020 Prion disease
    12390 (Cav2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12390 (Cav2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12390 (Cav2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    12390 (Cav2)
SSDB
Motif
Pfam: Caveolin SPC12
Other DBs
NCBI-GeneID: 12390
NCBI-ProteinID: NP_058596
MGI: 107571
Ensembl: ENSMUSG00000000058
Vega: OTTMUSG00000024026
UniProt: Q9WVC3
Position
6; 6 A2
AA seq 162 aa
MGLETEKADVQLFMADDAYSHHSGVDYADPEKYVDSSHDRDPHQLNSHLKLGFEDLIAEP
ETTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK
TCLMVLPSVQTIWKSVTDVVIGPLCTSVGRSFSSVSMQLSHD
NT seq 489 nt   +upstreamnt  +downstreamnt
atggggctggagaccgagaaggccgatgtgcagctcttcatggccgatgacgcctacagc
caccacagtggcgttgactacgcagatcctgagaagtatgttgactcgagtcacgaccgg
gatcctcaccagctcaactctcatctcaagctaggcttcgaggatctgattgcagagcct
gagactacacactcctttgacaaagtgtggatctgcagccatgctctctttgaaatcagc
aaatatgtgatgtacaagttcctgaccgtatttctggccatccccttggccttcattgcg
ggtatcctgtttgctaccctcagctgtctgcacatctggatcctgatgccttttgtgaag
acctgcctaatggtcttgccttccgtgcagacaatatggaagagtgtgacagacgttgtc
attggcccattgtgtacaagtgtgggccgcagcttctcatcggtcagcatgcaactgagc
cacgactga

KEGG   Mus musculus (mouse): 12391
Entry
12391             CDS       T01002                                 

Gene name
Cav3, AI385751, Cav, Cav-3, M-ca, M-cav
Definition
(RefSeq) caveolin 3
  KO
K12959  caveolin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04510  Focal adhesion
mmu05020  Prion disease
mmu05100  Bacterial invasion of epithelial cells
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12391 (Cav3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12391 (Cav3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    12391 (Cav3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12391 (Cav3)
  09164 Neurodegenerative disease
   05020 Prion disease
    12391 (Cav3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12391 (Cav3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12391 (Cav3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    12391 (Cav3)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 12391
NCBI-ProteinID: NP_031643
MGI: 107570
Ensembl: ENSMUSG00000062694
Vega: OTTMUSG00000056497
UniProt: P51637
Position
6 E3; 6 52.26 cM
AA seq 151 aa
MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKV
SFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSNIKVVLRREG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgatgaccgaagagcacacggatctggaagctcggatcatcaaggacattcactgcaag
gagatagacttggtgaaccgcgaccccaagaacatcaatgaggacattgtgaaggtagat
tttgaagacgtgattgcggagcccgagggcacctacagcttcgacggtgtatggaaggtg
agcttcaccacgttcaccgtctccaagtactggtgctaccgcctgttgtctacactgctg
ggtgttccactggccctgctctggggattcctgttcgcctgtatctccttctgccacatc
tgggccgtggtgccctgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactgtgtatccgcaccttctgcaacccgctcttcgctgcgttgggccaggtctgc
agcaacattaaggtggtgctgcgaagggaaggctaa

DBGET integrated database retrieval system