KEGG   Mus musculus (mouse): 12391Help
Entry
12391             CDS       T01002                                 

Gene name
Cav3, AI385751, Cav-3, M-cav
Definition
(RefSeq) caveolin 3
  KO
K12959  caveolin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04510  Focal adhesion
mmu05100  Bacterial invasion of epithelial cells
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12391 (Cav3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12391 (Cav3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    12391 (Cav3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12391 (Cav3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12391 (Cav3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12391 (Cav3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    12391 (Cav3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caveolin
Motif
Other DBs
NCBI-GeneID: 12391
NCBI-ProteinID: NP_031643
MGI: 107570
Ensembl: ENSMUSG00000062694
Vega: OTTMUSG00000056497
UniProt: P51637
Position
6 E3; 6 52.26 cM
AA seq 151 aa AA seqDB search
MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKV
SFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSNIKVVLRREG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgaagagcacacggatctggaagctcggatcatcaaggacattcactgcaag
gagatagacttggtgaaccgcgaccccaagaacatcaatgaggacattgtgaaggtagat
tttgaagacgtgattgcggagcccgagggcacctacagcttcgacggtgtatggaaggtg
agcttcaccacgttcaccgtctccaagtactggtgctaccgcctgttgtctacactgctg
ggtgttccactggccctgctctggggattcctgttcgcctgtatctccttctgccacatc
tgggccgtggtgccctgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactgtgtatccgcaccttctgcaacccgctcttcgctgcgttgggccaggtctgc
agcaacattaaggtggtgctgcgaagggaaggctaa

DBGET integrated database retrieval system