KEGG   Mus musculus (mouse): 12394
Entry
12394             CDS       T01002                                 

Gene name
Runx1, AM, AML1, CBF-alpha-2, Cbfa, Cbfa2, Pebp, Pebp2a2, Pebpa2b
Definition
(RefSeq) runt related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12394 (Runx1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    12394 (Runx1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12394 (Runx1)
   05202 Transcriptional misregulation in cancer
    12394 (Runx1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12394 (Runx1)
   05220 Chronic myeloid leukemia
    12394 (Runx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12394 (Runx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    12394 (Runx1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 12394
NCBI-ProteinID: NP_001104491
MGI: 99852
Ensembl: ENSMUSG00000022952
Vega: OTTMUSG00000049470
UniProt: Q3UM65
Structure
PDB: 

Position
16 C4; 16 53.7 cM
AA seq 465 aa
MASDSIFESFPSYPQCFMRDASTSRRFTPPSTALSPGKMSEALPLGAPDGGAALASKLRS
GDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVM
AGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAI
KITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASL
NHSTAFNPQPQSQMQDARQIQPSPPWSYDQSYQYLGSITSSSVHPATPISPGRASGMTSL
SAELSSRLSTAPDLTAFGDPRQFPTLPSISDPRMHYPGAFTYSPPVTSGIGIGMSAMSSA
SRYHTYLPPPYPGSSQAQAGPFQTGSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTN
ASTGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcttcagacagcatttttgagtcatttccttcatatccacagtgcttcatgagagat
gccagcacgagccgccgcttcacgccgccttccaccgcgctgagccccggcaagatgagc
gaggcgctgccgctgggcgccccggatggcggcgccgccctggccagcaagctgaggagc
ggcgaccgcagcatggtggaggtactagctgaccaccctggcgagctagtgcgcaccgac
agccccaacttcctctgctccgtgctacccactcactggcgctgcaacaagaccctgccc
atcgctttcaaggtggtggcactgggggacgtcccggatggcactctggtcaccgtcatg
gcaggcaacgatgaaaactactcggcagaactgagaaatgctaccgcggccatgaagaac
caggtagcgagattcaacgacctcaggtttgtcgggcggagcggtagaggcaagagcttc
actctgaccatcaccgtctttacaaatccgccacaagttgccacctaccatagagccatc
aaaatcacagtggacggcccccgagaaccccgaagacatcggcagaaactagatgatcag
accaagcccgggagtttgtccttttccgagcggctcagtgaattggagcagctgcggcgc
acggccatgagggtcagcccgcaccacccagcccccacgcccaaccctcgggcctccttg
aaccactccactgcctttaaccctcagcctcaaagtcagatgcaggatgccaggcagatc
cagccatccccaccgtggtcctatgaccagtcctaccagtacctgggatccatcacctct
tcctctgtccacccagcgacacccatttcacccggccgtgccagcggcatgaccagcctc
tctgcagaactttccagtcgactctcaacggctccggacctgaccgccttcggcgaccca
cgccagttccctactctgccgtccatctccgacccgcgcatgcactacccaggcgccttc
acctactcgccgcccgtcacgtcgggcatcggcatcggcatgtcagccatgagctcggcc
tctcgctaccacacctacctgccgccgccctaccccggctcatcacaggcgcaggccggg
cccttccagaccggctcgccctcctaccatctatactacggcgcctcggccggttcctac
cagttctccatggtgggcggagagagatcgcccccgcgcatcctgccgccctgcaccaac
gcatccaccggcgccgcgctgctcaaccccagcctccccagccagagcgacgtggtggag
accgagggcagccatagcaactcgcccaccaacatgccccccgcgcgcctggaggaggcc
gtgtggcggccctactga

KEGG   Mus musculus (mouse): 14013
Entry
14013             CDS       T01002                                 

Gene name
Mecom, D630039M04Rik, Ev, Evi, Evi-1, Evi1, Jb, Jbo, MDS1-E, Mds, Mds1, Mds1-Evi1, Prd, Prdm3, ZNFPR, Znfpr1b1
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
mmu01100  Metabolic pathways
mmu04010  MAPK signaling pathway
mmu05200  Pathways in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    14013 (Mecom)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14013 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14013 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    14013 (Mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14013 (Mecom)
   03036 Chromosome and associated proteins [BR:mmu03036]
    14013 (Mecom)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     14013 (Mecom)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    14013 (Mecom)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     14013 (Mecom)
SSDB
Other DBs
NCBI-GeneID: 14013
NCBI-ProteinID: NP_067417
MGI: 95457
Ensembl: ENSMUSG00000027684
Vega: OTTMUSG00000038143
UniProt: P14404
Position
3 A3; 3 12.66 cM
AA seq 129 aa
MRSKGRARKLATSNECAYGNYPEIPLEEMPDADADGITSVPSLHIQEPCSPATSSESFTP
KEGSPYKAPIYIPDDIPIPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDLK
DSSYGWENR
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgcctatggcaac
tatcctgaaatacctttggaagaaatgccagatgctgatgcagatgggataaccagtgtt
ccctccctccacattcaagagccatgctctcctgcgacgtccagtgagtcatttactcct
aaggagggctcgccatacaaagctcccatctacatccctgatgacatccctattcctgat
gagtttgagcttcgagagtcaactatgcctggagcaggacttggaatatggaccaaaagg
aagattgaaataggcgaaaagtttgggccatacatgggagagcagagatcagacctgaaa
gattccagctatggatgggagaacaggtga

DBGET integrated database retrieval system