KEGG   Mus musculus (mouse): 12396
Entry
12396             CDS       T01002                                 

Gene name
Cbfa2t2, A430091M07, C330013D05Rik, Cbfa2t2h, MTGR, MTGR1
Definition
(RefSeq) CBFA2/RUNX1 translocation partner 2
  KO
K22751  CBFA2/RUNX1 translocation partner 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    12396 (Cbfa2t2)
SSDB
Motif
Pfam: NHR2 TAFH zf-MYND BBS1 Remorin_C
Other DBs
NCBI-GeneID: 12396
NCBI-ProteinID: NP_766448
MGI: 1333833
Ensembl: ENSMUSG00000038533
Vega: OTTMUSG00000015790
UniProt: O70374 Q3UGB2
Position
2; 2 H1
AA seq 594 aa
MVGVPGAAAFQLGCEKRVPAMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTAL
SNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQF
GNDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQREL
LHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERD
TVPPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPN
KMLEHREVRERHHNLSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSM
AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPA
TGYVPVEFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQA
AEDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHG
HSPHSQSRPLLPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggtgggcgtccctggagcggccgccttccaacttggttgtgagaaaagggtgccagca
atgcctggatcgcctgtggaagtgaagatacagtcaagatcctcacctcccatcatgcca
cccctcccaccaataaatcctggaggaccgaggccagtgtcctttactcctacagcatta
agcaatggcatcaaccattcccctcctaccctgaatggtgccccatcgccaccacagaga
ttcagcaatgggcctgcctcctccacatcgtcagcactaacgaatcaacagctgccggct
acttgtggtgctcggcagctcagcaagttgaaacgcttcctcaccactctgcagcagttt
ggcaatgatatctcacctgagatcggcgagaaggttcggactctcgttctagccttggtg
aactcaacagtaacaattgaagaattccattgcaagctccaggaggccacaaactttcct
cttcgtccatttgtgattccatttctcaaggccaacctgcccctgctgcagcgagaactg
ctgcactgtgcccgggctgccaagcagaccccgtcccagtacctggcccagcatgagcac
cttctgctcaacaccagtatcgcatctcctgctgactcttctgaactgctcatggaggtt
catggaaatggaaagaggcccagtccggaaaggagggacgagaataattttgaaagagat
acagttcctcctgaaccgcctgccaagagagtgtgtactatcagccctgctcctcggcac
agtcccgccctcactgttccccttatgaatcctgggggccagttccatcctactccacca
cctcttcagcactatacactagaagacattgcaacttctcacctgtatcgggaaccaaac
aagatgctagaacaccgagaagttcgtgagaggcaccacaatcttagtctcaatggaggc
tatcaagatgagttggtagaccaccgtttgacagaaagggagtgggctgatgaatggaaa
caccttgaccatgcactgaattgcattatggaaatggtagagaaaactaggcgctccatg
gcagttctgaggcgctgtcaggaatctgaccgtgaagaactcaactattggaaacggcgg
tttaatgaaaatacagagttgaggaaaactgggactgagttggtctctaggcagcacagc
cctgggagtacagattctctcagcaacgattctcagcgggaatttaccagtagaccagca
acaggatatgtgcctgtggagttttggaagaaaacagaagaagccgtgaataaggtgaaa
attcaggccatgtcagaggtacagaaggctgtagctgaggcagagcaaaaagcctttgaa
gtgattgcaacggagagagctcgaatggagcagaccatagcggatgtcaaacggcaggct
gcagaagatgctttcctggtcatcaatgagcaagaagagtccacagagaactgctggaac
tgtggccgaaaagccagtgagacgtgcagtggctgcaacattgctcgctactgcggctcc
ttctgccagcataaggactgggagcggcaccaccgcctctgtggccagagtctacatggc
cacagtccccacagccagagcaggccactgctccctggagggcggggctcagccaggtct
gctgactgcagtgtgcccagcccagccctggacaagacctcagctaccacctcacggtcc
tcaacacctgcctctgtgacagccattgatgccaacgggctctaa

DBGET integrated database retrieval system