KEGG   Mus musculus (mouse): 12402
Entry
12402             CDS       T01002                                 

Gene name
Cbl, 4732447J05Rik, Cbl-, Cbl-2, c-Cb, c-Cbl
Definition
(RefSeq) Casitas B-lineage lymphoma
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04144  Endocytosis
mmu04910  Insulin signaling pathway
mmu05100  Bacterial invasion of epithelial cells
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12402 (Cbl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    12402 (Cbl)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12402 (Cbl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    12402 (Cbl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12402 (Cbl)
   05205 Proteoglycans in cancer
    12402 (Cbl)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    12402 (Cbl)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12402 (Cbl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12402 (Cbl)
   04121 Ubiquitin system [BR:mmu04121]
    12402 (Cbl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     12402 (Cbl)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    12402 (Cbl)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    12402 (Cbl)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4
Other DBs
NCBI-GeneID: 12402
NCBI-ProteinID: NP_031645
MGI: 88279
Ensembl: ENSMUSG00000034342
Vega: OTTMUSG00000058274
UniProt: P22682
Position
9 A5.1- A5.2; 9 24.72 cM
AA seq 913 aa
MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPCTVDKKMVEKCWKL
MDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENL
MKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRIT
KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD
IFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQ
WAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIK
VTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCE
IKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPS
SPFSMAPQASLPPVPPRLDLLQQRAPVPASTSVLGTASKAASGSLHKDKPLPIPPTLRDL
PPPPPPDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSSRPGDSWLSRPIPKVPVAT
PNPGDPWNGRELTNRHSLPFSLPSQMEPRADVPRLGSTFSLDTSMTMNSSPVAGPESEHP
KIKPSSSANAIYSLAARPLPMPKLPPGEQGESEEDTEYMTPTSRPVGVQKPEPKRPLEAT
QSSRACDCDQQIDSCTYEAMYNIQSQALSVAENSASGEGNLATAHTSTGPEESENEDDGY
DVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTNFNEGSQVPERPPKPFPRRINSER
KASSYQQGGGATANPVATAPSPQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILR
EFVSISSPAHVAT
NT seq 2742 nt   +upstreamnt  +downstreamnt
atggccggcaacgtgaagaagagctcgggcgccggcggcggcggctctgggggctcggga
gcgggcggcctgatcgggctcatgaaggacgccttccagccgcaccaccaccaccaccac
ctcagcccgcaccctccctgcacggtggacaagaagatggtggagaagtgctggaagctc
atggacaaggtggtgcggttgtgtcaaaacccaaagctggcgctcaagaacagcccgcct
tatatcttagacctgctgcctgacacctaccagcacctccgcactgtcttgtcaagatat
gaggggaagatggagacgcttggagaaaatgagtatttcagggtgttcatggaaaatttg
atgaagaaaactaagcagactatcagcctcttcaaggagggaaaagaaaggatgtatgag
gagaattcccagcctaggcgaaacctgaccaaattatccctgatcttcagccacatgctg
gcagaactgaaaggcatctttccgagcggactcttccaaggagacactttccggattact
aaagctgatgctgccgaattttggagaaaagcttttggtgaaaagacgatagtcccgtgg
aagagctttcgacaggccctgcatgaagtgcatcccatcagttctgggctggaggccatg
gctctgaagtccactattgatctgacctgcaatgattatatttctgtctttgaatttgat
atttttacacggctgtttcagccctggtcctctttgctcagaaattggaacagccttgct
gtaactcaccctggttacatggctttcctgacatacgatgaagtgaaagcgcgcctgcag
aagttcatccacaaacctggcagttacatctttcggctgagctgtactcgtttgggtcag
tgggctattgggtatgttactgccgatgggaacattctgcagacaatcccacacaataaa
ccgctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcctgatgga
cgaaatcaaaatcctgacctgacaggtttatgtgaaccaactcctcaagatcatatcaaa
gtaacccaggaacaatatgaattatactgtgaaatgggctccacatttcaactgtgtaag
atatgtgctgagaatgataaggatgtgaagattgagccctgtggacacctcatgtgcaca
tcctgcctcacgtcgtggcaggaatcagaaggtcagggctgtcctttttgccgatgtgaa
atcaaaggtactgagcccatcgtggtggatccgtttgaccccagaggcagtggcagccta
ttaaggcaaggagcagaaggtgctccttccccaaattacgacgatgatgatgatgaacga
gctgatgattctctcttcatgatgaaggagttggcaggtgccaaggtggaaaggccttcc
tctccattctccatggccccacaagcttcccttcctccagtgccaccaagacttgacctt
ctacagcagcgagcacctgttcctgccagcacttcagttctggggactgcttccaaggct
gcttctggctcccttcataaagacaaaccattgccaatacctcccacacttcgagatctt
ccaccaccaccccctccagaccggccttactctgttggagcagaaacaaggcctcagaga
cgccctctgccttgtacaccaggcgattgtccatctagagacaaactgccccctgtccct
tctagccgcccaggggactcgtggttgtctcggccaatccctaaagtaccagtagctact
ccaaaccctggtgatccttggaatgggagagaattgaccaatcggcactcgcttccattc
tcattgccctcacaaatggaacccagagcagatgtccctaggcttggaagcacatttagt
ctggatacctctatgactatgaatagcagcccagtagcaggtccagagagtgagcaccca
aagatcaagccttcctcgtctgccaacgccatttactctctggctgccaggcctcttcct
atgccaaaactgccacctggggagcaaggggaaagtgaagaggacacagaatatatgact
cccacatctaggcctgtaggggttcagaagccagagcccaaacggccgttagaggcaacc
cagagttcacgagcatgtgactgtgaccagcagatcgacagctgtacctatgaagcgatg
tataacatccagtcccaagcactgtctgtagcagaaaacagcgcctctggggaagggaat
ctggccacagctcacacgagtactggccctgaggaatccgaaaacgaggatgatggctat
gatgtgcctaagccacccgtgccagctgtactggcccgccggaccctgtctgacatctcc
aatgccagctcctcctttggctggttgtctttggatggtgaccctacaaacttcaatgag
ggttcccaagttcctgagcggccccccaaaccattccctcggagaatcaactcagaacga
aaagccagtagctatcaacaaggcggaggtgccactgctaaccctgtggccacagcaccc
tcaccgcagctctcaagtgagattgaacgcctcatgagtcagggctattcctaccaggac
attcagaaagctttggtcattgcccacaacaacattgagatggctaaaaacatcctccgg
gaatttgtttctatttcttctcctgctcacgtagccacctag

KEGG   Mus musculus (mouse): 208650
Entry
208650            CDS       T01002                                 

Gene name
Cblb, AI429560, AI851073, Cbl-, Cbl-b
Definition
(RefSeq) Casitas B-lineage lymphoma b
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04144  Endocytosis
mmu04625  C-type lectin receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04910  Insulin signaling pathway
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    208650 (Cblb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    208650 (Cblb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    208650 (Cblb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    208650 (Cblb)
   04660 T cell receptor signaling pathway
    208650 (Cblb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    208650 (Cblb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    208650 (Cblb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    208650 (Cblb)
   04121 Ubiquitin system [BR:mmu04121]
    208650 (Cblb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     208650 (Cblb)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    208650 (Cblb)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    208650 (Cblb)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_2 zf-RING_5 zf-rbx1 UBA zf-RING_4 zf-C3HC4_4
Other DBs
NCBI-GeneID: 208650
NCBI-ProteinID: NP_001028410
MGI: 2146430
Ensembl: ENSMUSG00000022637
UniProt: Q3TTA7 B9EKI5
Structure
PDB: 
5AXI

Position
16; 16 B5
AA seq 938 aa
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFSIPMLDLDDDDDREESLMMNRLASVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPERPPPIPPDNRLSRHFHHGESVPSRDQPMPLEAWCPRDAFGT
NQVMGCRILGDGSPKPGVTANSSLNGRHSRMGSEQVLMRKHRRHDLPSEGAKVFSNGHLA
TEEYDVPPRLSPPPPVTTLLPSIKCTGPLANCLSEKTRDTVEDDDDEYKIPSSHPVSLNS
QPSHCHNVKAPVRSCDNGHCILNGTHGAPSEMKKSNIPDLGIYLKGEDAFDALPPSLPPP
PPPARHSLIEHSKPPGSSSRPSSGQDLFLLPSDPFFDPTSGQVPLPPARRAAGDSGKANR
ASQDYDQLPSSSDGSQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGY
AFEEVKRALEIAQNNVEVARSILREFAFPPPVSPRLNL
NT seq 2817 nt   +upstreamnt  +downstreamnt
atggcaaattctatgaatggcagaaatcctggtggtcgaggaggaaacccccgcaaaggt
cgcattttggggattattgatgctattcaggatgcagtcggacccccaaagcaagctgca
gctgaccgcaggactgtggagaagacttggaaactcatggacaaagtggtaagactgtgc
caaaatcccaagcttcagttgaaaaacagcccaccgtatatacttgatattttacctgat
acgtatcagcacttgagacttatattgagtaaatatgatgacaaccagaagctggctcaa
ctgagcgagaatgagtactttaaaatctacatcgatagtctcatgaagaagtcgaagcga
gcgatccggctctttaaagaaggcaaggaaaggatgtacgaagagcagtcgcaggacaga
cggaatctcacaaagctgtcccttatcttcagtcacatgctggcagaaatcaaggcgatc
tttcccaatggccagttccagggagataacttccggatcaccaaagcagatgctgctgag
ttctggaggaagttttttggagacaaaactattgtaccatggaaagtcttcagacagtgc
ctgcatgaggtccatcagatcagctctggcctggaagcaatggctctgaagtcaaccatt
gatttaacttgcaatgattacatctcagtgtttgaatttgatatttttaccaggctattt
cagccctggggctctattttacggaattggaacttcttggctgtgactcacccgggatac
atggcatttctcacgtatgatgaagttaaagctcggctacagaaatacagcaccaagcct
ggaagttacattttccggttaagctgcactcggctgggacaatgggccattggctatgtg
actggggacggcaatatcctacagaccatacctcataacaagcccctgttccaagccctg
attgatggtagcagggaaggcttttatctttatcctgatgggcggagctataaccctgat
ttaaccggattatgtgaacctacacctcacgatcatataaaagttacacaggagcagtat
gaactgtattgtgaaatgggctccacttttcagctctgcaagatctgtgcagagaatgac
aaagatgtcaagattgagccttgcgggcatctgatgtgcacttcgtgccttaccgcgtgg
caggagtctgatggccaaggctgccccttctgtcgctgtgagataaaaggaacggagccc
atcattgtggaccccttcgaccccagagatgaaggctccaggtgctgcagcatcattgac
cctttcagcatccccatgcttgacttggacgatgacgatgatcgagaggagtctttgatg
atgaacaggctggcgagtgttcgaaagtgcacggacaggcagaactcaccagtcacatcg
ccaggctcctcaccccttgcccagagaagaaagcctcagccagaccctctccagatcccc
cacctcagcctgccaccagtgcctccccgcctagatctcattcagaaaggcatcgtgcgc
tctccgtgtggcagccccacaggctcgccaaagtcttctccatgcatggttagaaaacaa
gacaaaccactcccggcaccccctcctcccttgagagatccacctcctccaccagagagg
cctccccccatcccacctgacaatagactgagcagacacttccaccatggagagagtgtg
ccttcccgggaccagcccatgcccctcgaagcctggtgccctcgggatgccttcgggact
aaccaggtgatgggatgtcgcatcctcggggatggctctccaaagcctggcgtcaccgca
aactccagcttaaatgggaggcacagtagaatgggctccgagcaggttcttatgaggaaa
cacagacgccatgatttgccttcagaaggagccaaggtcttttccaatggccaccttgcc
actgaagaatacgatgtccctcctcggctttcccctccgcctccagtcaccacccttctc
ccaagcataaagtgtactggtccattagcaaattgtctctcagagaaaactagagacacg
gtagaagatgatgacgatgaatacaagattccttcatcccatcctgtgtccctgaattca
caaccatctcattgccataatgtcaaagctcctgttcggtcttgtgataatggtcattgt
atattgaatggaactcatggtgcgccttcagagatgaagaaatcgaacatcccagattta
ggcatctatttgaagggtgaggacgcctttgatgctctccctccatccctccctcctccc
ccacctcctgcaagacacagtctcatcgaacattcaaaacctccaggctccagtagccgg
ccttcctcagggcaggaccttttccttcttccttcagatcccttttttgacccaacaagt
ggccaagttccattgcctcctgccaggagagcagcaggagacagcggcaaagccaacaga
gcctcgcaggactatgaccagctcccttcatcttccgatggttcgcaagcaccagctaga
ccccccaaaccacgaccccgaaggactgcaccagaaattcatcacagaaagccccatggg
cccgaagcggcgttggaaaatgtcgatgcaaaaattgcaaaactcatgggagaggggtat
gcctttgaagaggtgaagagagccttagagattgcccagaataacgtggaagtggccagg
agcatacttcgagaatttgccttcccccctcctgtctccccacgtctgaatctatag

KEGG   Mus musculus (mouse): 80794
Entry
80794             CDS       T01002                                 

Gene name
Cblc, 2310076I21Rik, 2310079L19Rik, Cbl, Cbl3
Definition
(RefSeq) Casitas B-lineage lymphoma c
  KO
K22518  E3 ubiquitin-protein ligase CBL-C [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    80794 (Cblc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    80794 (Cblc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    80794 (Cblc)
   04121 Ubiquitin system [BR:mmu04121]
    80794 (Cblc)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     80794 (Cblc)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    80794 (Cblc)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    80794 (Cblc)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX
Other DBs
NCBI-GeneID: 80794
NCBI-ProteinID: NP_075713
MGI: 1931457
Ensembl: ENSMUSG00000040525
Vega: OTTMUSG00000029153
UniProt: Q80XL1
Position
7; 7 A3
AA seq 496 aa
MAAAAAPRGWQRGEPRALSRAVKLLQRLEEQCRDPRMVTGPPSLRDLLPRTAQLLGEVAK
ARREAREDPEGPGGADDFLAIYLANLEVKGRQVAELLPPRGKKDVNQDVFREGSRFRRQL
AKLALIFSHMHAELSALFPAGKYCGHLYQLTKGSAHIFWRQNCGVRCVLPWAEFQSLLCA
CHPVEPGPTMQALRSTLDLTCNGHVSVFEFDVFTRLFQPWPTLLRNWQLLAVNHPGYMAF
LTYDEVQTRLQAYRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPLNKPLLQVLLKG
QKDGIFLFPDGKKHNPDLTELCRVEPYQRIQVSEEQLLLYQAMNSTFQLCKICAERDKDV
RIEPCGHLLCSCCLAAWQDSDSQTCPFCRCEIKGREAVSICQAQERPTEVRTAADGSRDN
CHQEAAEQKLGPVIPSAPSLLPEDQFPQGPQDKGWLTLAPLALPRLRPPLPLPKMASVLW
EVTSRPRAREEATESS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggctgcggcggcagccccgcgagggtggcagcggggcgagccacgcgcgcttagccgg
gcggtgaagttgctccagcgcctagaagagcaatgcagggatcccaggatggtcacgggg
cccccgtccctgcgggacctgctgccccgcaccgcgcagctacttggagaggtggcaaag
gcccggcgcgaggccagggaagaccccgagggtcccggtggcgccgatgactttctggcc
atctacctggccaatctggaggtcaaaggcaggcaggtggcggagctcctgccaccccga
ggcaaaaaggacgtgaaccaggatgttttccgggagggctccagattcaggcgacaactg
gccaagctggccctcatcttcagtcacatgcacgcggagttgagcgcactcttccctgct
gggaagtactgtgggcacctgtaccagctcaccaagggctctgcccacatcttctggagg
cagaattgtggagttcggtgcgtgcttccctgggctgagttccagtccctcctgtgtgcc
tgccaccctgtggaaccaggccccaccatgcaggccttgcggtccaccttggacctcacc
tgtaacggccacgtgtctgtctttgagtttgacgtcttcaccaggctctttcagccgtgg
cccactttactgaggaattggcaactcctggctgtcaaccatcctggctacatggccttc
ctcacctacgatgaggtccaaacacgcctgcaggcctacagggacaaaccaggcagctat
atcttccggccaagctgtacccgcctggggcagtgggccattggatacgtgagctccgat
ggaagcatcctgcaaaccattcctctcaacaaacctctgctgcaggtgctcctgaaggga
caaaaggacggcatcttcctcttccctgatggaaagaaacacaacccagacctgactgag
ctctgccgggtagaaccctaccaacgcatccaagtgtcagaggaacaactgctgctctac
caagccatgaactccacgttccagctgtgcaagatctgcgcagagagggacaaggacgtg
aggatcgagccctgtgggcatcttctctgcagctgctgcctggctgcctggcaggactca
gacagccagacctgtcccttctgccgttgtgagatcaaaggtcgagaggccgtgagtatc
tgtcaggcacaggagaggccaacggaggtcaggactgctgcagatggctcaagagacaac
tgtcaccaggaggctgctgagcagaaactggggccggtgattccctctgctccctcacta
ctccctgaagatcagttccctcagggaccccaagacaaaggctggctgacactggcacca
ctcgccctgcccaggctccgacctccacttcctctccccaaaatggcctcggttctgtgg
gaagtcacctccaggccccgggccagggaggaggccacagaaagctcctga

DBGET integrated database retrieval system