KEGG   Mus musculus (mouse): 12406
Entry
12406             CDS       T01002                                 

Gene name
Serpinh1, BERF-1, Cbp, Cbp1, Cbp2, Hsp, Hsp47, J6, Ser, Serpinh2, co, gp4, gp46
Definition
(RefSeq) serine (or cysteine) peptidase inhibitor, clade H, member 1
  KO
K09501  serpin peptidase inhibitor, clade H, member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12406 (Serpinh1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12406 (Serpinh1)
   04131 Membrane trafficking [BR:mmu04131]
    12406 (Serpinh1)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   12406 (Serpinh1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP47
   12406 (Serpinh1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    12406 (Serpinh1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 12406
NCBI-ProteinID: NP_001104513
MGI: 88283
Ensembl: ENSMUSG00000070436
Vega: OTTMUSG00000058974
UniProt: P19324
Position
7; 7 E1
AA seq 417 aa
MRSLLLGTLCLLAVALAAEVKKPLEAAAPGTAEKLSSKATTLAERSTGLAFSLYQAMAKD
QAVENILLSPLVVASSLGLVSLGGKATTASQAKAVLSAEKLRDEEVHTGLGELLRSLSNS
TARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWASQTT
DGKLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTG
LYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKAWMGKMQKKA
VAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEWDT
EGNPFDQDIYGREELRSPKLFYADHPFIFLVRDNQSGSLLFIGRLVRPKGDKMRDEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgcgctctctccttctgggcaccttatgcctcttggccgtggccctggcagccgaggtg
aagaaacccctagaggcggcagcccctggtactgcggagaagctaagttccaaggcgacc
acactggcagagcgcagcacaggcctggccttcagcctatatcaggcgatggccaaagac
caggcggtggagaacatcctcctgtcacccttggtggtggcctcatccctgggtcttgtg
tcactgggtggtaaagccaccacagcgtcgcaggcgaaggcagtgctgagcgctgagaag
ctgcgcgatgaggaggtgcacacggggctgggtgagctgctccgctccctcagcaactcc
actgcgcgcaacgtgacctggaaactgggcagccgcctgtacgggcccagctccgtgagc
ttcgccgatgacttcgtgcgcagcagcaagcaacactacaactgcgaacactccaagatc
aacttccgagacaagcgcagcgccctgcagtccatcaacgagtgggcctcgcagaccacg
gacggcaagctgcctgaggtcaccaaggatgtggagcgcacggatggggcactgcttgtg
aacgccatgttctttaagccacactgggatgagaagtttcaccacaagatggtggacaac
cgtggcttcatggtgacccgctcctatactgtgggtgttacgatgatgcaccggacaggc
ctgtacaactactatgacgacgagaaggagaagctgcagatggtggagatgcccctggct
cacaagctctccagcctcatcatcctcatgccccaccacgtggagccgctcgagcgcttg
gagaagctgctgaccaaggagcagctgaaggcctggatgggaaagatgcagaagaaggct
gtcgccatctccctgcccaagggcgtggtggaggtgacccatgacctgcagaaacatctg
gcaggactgggcctgaccgaggccatcgacaagaacaaggcagacctatcgcgcatgtct
ggcaagaaggacctgtacctagccagtgtgttccatgccactgccttcgagtgggacacc
gagggcaacccctttgaccaagacatctacgggcgcgaggagctgcgcagccccaagctg
ttctatgccgaccaccccttcatcttcctggtgcgagataatcagagcggctccttgctc
ttcattggccgcctggtccggcccaagggagacaagatgcgagatgagttgtag

DBGET integrated database retrieval system