KEGG   Mus musculus (mouse): 12421
Entry
12421             CDS       T01002                                 

Gene name
Rb1cc1, 2900055E04Rik, 5930404L04Rik, Cc1, FIP200, Fip2, LaXp, LaXp180
Definition
(RefSeq) RB1-inducible coiled-coil 1
  KO
K17589  RB1-inducible coiled-coil protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu04211  Longevity regulating pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    12421 (Rb1cc1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    12421 (Rb1cc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12421 (Rb1cc1)
   05014 Amyotrophic lateral sclerosis
    12421 (Rb1cc1)
   05016 Huntington disease
    12421 (Rb1cc1)
   05017 Spinocerebellar ataxia
    12421 (Rb1cc1)
   05022 Pathways of neurodegeneration - multiple diseases
    12421 (Rb1cc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    12421 (Rb1cc1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12421 (Rb1cc1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    12421 (Rb1cc1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12421 (Rb1cc1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    12421 (Rb1cc1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    12421 (Rb1cc1)
SSDB
Motif
Pfam: ATG11 TBK1_ULD
Other DBs
NCBI-GeneID: 12421
NCBI-ProteinID: NP_033956
MGI: 1341850
Ensembl: ENSMUSG00000025907
Vega: OTTMUSG00000033467
UniProt: Q9ESK9
Position
1; 1 A1
AA seq 1588 aa
MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVC
TYSAGTDTNPIFLFNKEMILCDRAPAIPKATFSTENDMEIKVEESLMMPAVFHTVASRTQ
LAVEMYDVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSDYLQ
SIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRPDSLNEHEGSEKAEMKRSTEL
VLSPDMPRTTNTSLVTSFHKSMEHVAPDPTGTERGKELRESCQSTVQQEEASVDAKDSDL
PFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPKIIQPFMLECHQTIAKLDNQNMKA
IKGLEDRLYALDQMIASCSRLVNEQKELAQGFLANQMRAENLKDASVLPDLCLSHANQLM
IMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLE
RVRIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKQLYEAEKSKRESFGKL
FRKSFLRNRLFKGLDSWPSSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPL
LCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLNEQKVSTSQASPQSAASPRIESTTG
ITTTTSPKTPPPLTVQDTLCPAVCPLEELSPDSIDAHTFDFETISHPNTEQPVHQASIDL
DSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDTS
TRGNEGFGDRAALHVQLEKCRAAAQDSHSSIQTIKDDLCHFRTFVQKEQCDLANYLKCTA
VEIRNIIEKVKCSLEITLKEKHQQELQSLKIEYECKLDALVKDSEENVNKILKLKENLVS
LEEALQNKDNEFTSIKHEKDAIVCVQQEKDQKLLEMEKIMHTQHCEIKELKQSREMALED
LKKLHDEKIESLRAEFQCLEQNHLKELEDTLHIRHTQEFEKVMTDHNMSLEKLKKENQQR
IDQMLESHASTIQEKEQQLQELKLKVSDLSDMRCKLEVELALKEAETDEIKILLEESRTQ
QKEMLKSLLEQETENLRTEISKLNQKIHDNNESYQVGLSELRALMTIEKDQCISELISRH
EEESNILKAELDNVTSLHRQAYEIEKKLKEQIVELQTRLNSELSALEKQKDEKITQQEEK
YEALIQNLEKDKERLVKNHEQDKEHLIQELNFEKNKAVQTALDEFKVERELVEKELLEKV
KHLENQIAKTPAFESAREDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSL
IAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKQ
LEEEVSKLRTSSFLSSAPVAAAPELYGACAPELPGEPERSVMETADEGRLDSAMETSMMS
VQENMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSLSSVSSRHSEKIAIRDFQVGDL
VLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQ
AKKAQNRFKVPLGTKFYRVKAVSWNKKV
NT seq 4767 nt   +upstreamnt  +downstreamnt
atgaagttatatgtgtttctggttaacaccggaaccacgctgacatttgacactgagcta
actgtgcaaactgtggctgatcttaagcatgccattcaaagcaaatacaagattgctatt
cagcaccaggttctggtggtcaatggaggagaatgcatggctgcagatcgaagagtgtgt
acttacagcgctgggacggacacaaatccaatttttctttttaataaagaaatgatctta
tgtgaccgtgcacctgctattcctaaagctaccttttcaacagaaaatgacatggaaata
aaagttgaagagtctcttatgatgcctgcagttttccacactgttgcttcaaggacacag
cttgcagtggaaatgtatgacgttgccaagaagctctgctctttctgtgaagggcttgtc
catgatgaacatcttcagcaccaaggctgggctgcaatcatggccaatctggaggactgt
tcaaattcataccaaaaacttcttttcaagtttgaaagtatttattctgattatcttcaa
tccatagaagacatcaagttaaaacttactcatttaggaactgctgtttcagtaatggcc
aagattccactattggagtgcctaaccagacatagttacagggaatgtttgggaagaccg
gattctttgaatgaacatgaaggctcagagaaagctgagatgaaaagatctactgaactg
gtgctctctcctgatatgcctagaacaacgaacacatccttggtaacctcatttcacaag
tcaatggagcatgtagctccagatcccaccggtactgaacgtggcaaagaacttagggaa
tcttgtcaaagtactgtccagcaagaagaagcttcagtggatgctaaagacagtgatctg
cctttttttaatgtttctttgttagactggataaatgttcaagatagacccaatgatgtg
gaatctctggtcaggaagtgctttgattctatgagcaggcttgacccaaagattattcaa
ccatttatgttagaatgccatcaaactattgccaaacttgataatcagaatatgaaagcc
attaaagggcttgaagatcggctgtatgccttggaccagatgattgctagctgtagccgg
ctggtaaatgaacagaaagagcttgctcagggatttttagctaatcagatgagagctgaa
aacttgaaggatgcatctgtgttacctgatctgtgtctgagtcatgcaaatcaactaatg
attatgttgcaaaaccacagaaaactgttggatattaaacagaagtgcaccactgccaaa
caagagctagcaaacaatctccacgtcagactgaagtggtgttgttttgtgatgcttcat
gctgatcaagatggagaaaaactgcaggcactgctccgccttgtaatagagctgttagaa
agagtcagaattgttgaggctcttagtacagttcctcagatgtattgcctagctgttgtt
gaggttgtaagaagaaaaatgttcattaaacactacagagagtgggctggtgctttagtc
aaagacggaaaacaactatatgaagctgaaaagtcaaaaagggaatcctttgggaaatta
tttaggaagtcctttttaagaaatcgtctgtttaaaggactggactcctggccttcctca
ttttgtactcagaagcctcgaaaatttgactgtgaacttccagatatatcattaaaagat
ttacagtttcttcaatcattttgtccttcagaagtgcagccattcctcagggtcccctta
ctttgtgactttgaacctctacaccagcatgtacttgccctacataatttggtaaaagca
gcacaaagtttggatgaaatgtcacagactattacagatctcctaaatgaacaaaaggta
tccacaagtcaggcatccccacagtcagctgcttctccaagaatagaaagtacaacaggc
attacaaccactacctcaccaaaaactcctcctccactaactgttcaggacaccttatgt
ccggcagtgtgtcccttagaagaattatctccagatagtatcgatgctcatacatttgat
ttcgaaaccatctcccatccaaacacagaacaacctgttcaccaagcttctatagacttg
gattcattagcagaaagccctgagtctgactttatgtctgctgtgaatgagtttgtgata
gaagaaaatttatcgtctccaaaccctataagtgatccacaaagtccagaaatgatggtg
gagtcactttactcttcagtcatcaatgcaatagatagtaggcgtatgcaagacacaagt
acacgtggaaacgagggctttggggatcgggctgctctacatgtccagctggagaaatgc
agagctgctgcacaagactctcacagcagtatacaaaccatcaaggacgatctgtgccat
ttcagaacatttgtacaaaaagaacagtgtgacttagcaaattatttaaaatgtacagct
gtagaaataagaaatattattgaaaaagtaaaatgttctctagaaataacactaaaggaa
aagcatcagcaagaactccaatctttaaaaattgagtatgaatgtaaacttgatgctcta
gtaaaagacagtgaagaaaatgtaaataaaattttaaaattgaaagaaaatttagtatcc
cttgaagaggctttacaaaataaagacaatgaattcacttcgattaaacatgaaaaggat
gctattgtctgtgtgcagcaagaaaaggatcagaagttgttagagatggaaaagataatg
catactcaacattgtgaaattaaagaactgaagcagtcacgagagatggcattagaagac
ctgaaaaagctgcatgatgaaaaaatcgagtcattgagagctgaatttcagtgcttagaa
caaaatcacctgaaggaattagaggacacactgcacatcaggcacacacaggagtttgag
aaagttatgacagaccacaatatgtctttggagaaattaaaaaaagaaaatcagcaaaga
attgaccagatgctagaatctcatgcctcaactattcaggaaaaagagcaacagctgcag
gagttgaaactcaaagtttctgacttgtcagacatgagatgtaagttagaggttgaactt
gcactaaaggaagcagaaacagatgagataaagatcttgttggaagagagcagaacacag
cagaaggaaatgctgaagtctttacttgaacaagagaccgaaaacttaagaacagaaata
agtaaactaaaccaaaaaattcatgataataatgagagttaccaggtgggtttgtcagag
ttaagagctttaatgacaattgaaaaagatcagtgcatttcagagttaatcagtagacat
gaagaagaatctaatatacttaaggctgaattagacaatgttacatctttgcatcgccaa
gcatatgaaatagaaaaaaaactgaaagaacaaatagttgaattgcagactagattgaac
tcagaattgagtgctcttgaaaaacagaaagatgaaaaaataacccaacaagaagagaag
tatgaagcacttatccagaaccttgagaaagacaaggagagactggtcaagaaccacgag
caagacaaagaacacttaattcaggagcttaattttgaaaaaaacaaagctgttcaaact
gcactagatgaatttaaggtggagagagaacttgttgagaaagagttattagaaaaagtt
aaacatcttgagaatcaaatagccaaaactcctgcctttgagtcagccagagaagattct
tcaagcttagttgcggaacttcaagagaaacttcaagaagaaaaagctaagtttctggaa
caacttgaagaacaagagaaaagaaagaatgaggaaatgcaaaatgtcagaacctctttg
attgctgagcagcagaccaactttaacacagtcttaacaagagagaaaatgaggaaagaa
aacataataaatgatcttagtgataagctaaaaagtacaatgcagcagcaagagcgggat
aaagatttgatagagtcgctctctgaggaccgagctcgtttgcttgaagagaagaagcag
cttgaagaggaagtgagtaaactccgcactagcagttttctttcctcagcacctgtggct
gcagccccagagctctatggtgcgtgtgcacctgagctcccaggggagccagagagatca
gtcatggagacggcagatgaaggaagactggattccgcaatggagacaagcatgatgtct
gtccaagaaaacatgttatctgaagagaagcagaggatcatgctcctagaacggacattg
cagttgaaagaagaagaaaacaagcggttaaatcaaagactgatgtctcagagtttgtcc
tcagtctcttcaaggcattctgaaaaaatagccattagagattttcaggtgggagatttg
gttctcatcatcctagatgagcggcacgacaattatgtattgtttactgttagtcctact
ttatattttctgcactcagagtctcttcctgccctggatctcaaaccaggtgagggagct
tcaggtgcatctagaagaccctgggtccttgggaaagtaatggaaaaggaatactgtcaa
gccaaaaaggcacaaaacagatttaaagttcctttggggacaaagttttacagagtgaaa
gctgtgtcatggaataagaaagtatag

DBGET integrated database retrieval system