KEGG   Mus musculus (mouse): 12427
Entry
12427             CDS       T01002                                 

Gene name
Ccna1
Definition
(RefSeq) cyclin A1
  KO
K06627  cyclin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04152  AMPK signaling pathway
mmu04218  Cellular senescence
mmu04914  Progesterone-mediated oocyte maturation
mmu05161  Hepatitis B
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    12427 (Ccna1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12427 (Ccna1)
   04218 Cellular senescence
    12427 (Ccna1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12427 (Ccna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12427 (Ccna1)
   05202 Transcriptional misregulation in cancer
    12427 (Ccna1)
   05203 Viral carcinogenesis
    12427 (Ccna1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12427 (Ccna1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12427 (Ccna1)
   05161 Hepatitis B
    12427 (Ccna1)
   05169 Epstein-Barr virus infection
    12427 (Ccna1)
   05165 Human papillomavirus infection
    12427 (Ccna1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12427 (Ccna1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12427 (Ccna1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    12427 (Ccna1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    12427 (Ccna1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2 Peroxidase_2
Other DBs
NCBI-GeneID: 12427
NCBI-ProteinID: NP_001292150
MGI: 108042
Ensembl: ENSMUSG00000027793
Vega: OTTMUSG00000053079
UniProt: Q61456
Position
3; 3 C
AA seq 421 aa
MHRQSSKSGVALPPVGQGPDACQMLSRAQLGQDPPQRTVLGVLTENEQYRRTCGQEITAI
RCFSGSENVFPAAGKKVLSDHGVNEPAKRGFDIYMDDPEQGDRDTCSGKEGIIFEDVYEV
DTSMLKSDLHFLLDFNTVSPMLVDPTTHAQSEEATDFGSDVINVTEYAEEIHRYLREAEV
RHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLVAAAAYCLANYIVNRHFW
PETLAAFTGYSLNEIVPCLSELHKACLSIPHRPQQAIREKYKASKYLHVSLMEPPVVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcatcgccagagctccaagagtggagtcgctctgcctccagtgggccaaggtcctgat
gcttgtcaaatgctcagcagagctcagcttggccaggatcccccacagagaaccgtgcta
ggggtgttgactgaaaatgagcagtacaggaggacctgtggccaggagatcacagcaatc
agatgtttttctggatcagaaaatgtcttccctgcggctggaaagaaagtgctctctgac
catggggtcaatgaaccagccaaacgtgggtttgatatctatatggatgatcctgaacag
ggggacagagatacctgctcggggaaagagggcatcatatttgaggatgtgtatgaagtc
gacaccagcatgctcaagtcagatctccacttcctgctggatttcaacacagtttcccca
atgctggttgaccccaccacccatgcccagtcagaggaagcaacggattttggttcagat
gtgattaacgtaacggagtatgcagaggagattcatcgctaccttcgagaagctgaagta
agacacagacccaaggctcactacatgaggaagcagccggacatcacggagggcatgcgc
gccatcctggtggactggctggtggaggttggggaagaatataaacttcgcacagagacc
ctgtacttggctgtcaacttcctggacaggtttctctcctgcatgtctgttctgagaggg
aaattgcagcttgtcgggacagcagctattctcctggcttcgaaatatgaagagatatat
ccgcccgacgtggatgagtttgtctacatcaccgacgatacgtacacaaagcgacagcta
ctgaggatggagcatctgctactcaaagtcctggcatttgatctgaccgttccaaccacc
aaccaattcctccttcagtacctaaggcgtcaaggagtgtgcatcaggactgagaatttg
gccaagtatgttgcagaactgagccttctggaagctgacccattcttgaagtatcttcct
tccttggttgctgcagcagcttactgcctggcaaactatattgtgaacagacacttctgg
ccagaaacacttgctgcatttacgggctattcattaaatgagattgtgccttgcctgagt
gagctgcataaagcatgcctcagtatcccccatcgaccgcagcaagcaatcagggagaag
tacaaggcttcgaagtacctgcacgtgtccctcatggagccgcctgtagttcttcccctg
cagtga

KEGG   Mus musculus (mouse): 12428
Entry
12428             CDS       T01002                                 

Gene name
Ccna2, AA408589, Cc, Ccn, Ccn-, Ccn-1, Ccn1, Ccna, Cyc, CycA2, Cyca
Definition
(RefSeq) cyclin A2
  KO
K06627  cyclin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04152  AMPK signaling pathway
mmu04218  Cellular senescence
mmu04914  Progesterone-mediated oocyte maturation
mmu05161  Hepatitis B
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    12428 (Ccna2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12428 (Ccna2)
   04218 Cellular senescence
    12428 (Ccna2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12428 (Ccna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12428 (Ccna2)
   05202 Transcriptional misregulation in cancer
    12428 (Ccna2)
   05203 Viral carcinogenesis
    12428 (Ccna2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12428 (Ccna2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12428 (Ccna2)
   05161 Hepatitis B
    12428 (Ccna2)
   05169 Epstein-Barr virus infection
    12428 (Ccna2)
   05165 Human papillomavirus infection
    12428 (Ccna2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12428 (Ccna2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12428 (Ccna2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    12428 (Ccna2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    12428 (Ccna2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 12428
NCBI-ProteinID: NP_033958
MGI: 108069
Ensembl: ENSMUSG00000027715
Vega: OTTMUSG00000006485
UniProt: P51943
Structure
PDB: 
3QHW 4I3Z 4II5 3QHR

Position
3 B; 3 17.67 cM
AA seq 422 aa
MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKT
RRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFN
AAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREME
VKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLR
GKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPT
VNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQ
SWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETL
SV
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgccgggcacctcgaggcattcgggtcgcgatgcgggctcagccctgctctcgctgcat
caggaagaccaagagaatgtcaaccccgaaaaactggcgccagcccagcagccgcgggcg
caggcggtgctgaaggccgggaacgtgcgtggacccgcgccgcagcagaagctcaagact
cgacgggttgctcctcttaaggaccttcctataaacgatgagcatgtcactgctggtcct
tcatggaaagcagtcagtaaacagcctgccttcaccattcatgtggatgaagcagaagag
actcagaagaggccagctgagcttaaagaaacagagtgtgaagatgccctggcttttaat
gcagctgtctctttacccggagcaagaaaaccactgacacctcttgactatccaatggat
ggcagttttgaatcaccacatgctatggatatgtctattgtcttagaagacaagccagtg
aacgttaatgaagtacctgactatcaagaagacattcacacgtaccttagggaaatggag
gttaaatgtaaacctaaagtgggttacatgaagaggcagccagacatcactaacagcatg
agggccatccttgtggactggctggttgaggtgggagaagaatataaactacagaatgag
accctgcatttggctgtgaactacattgatagattcctctcctccatgtctgtgttaaga
gggaagcttcagcttgtaggcacggctgctatgctgctagcttcgaagtttgaagaaata
taccccccagaagtagcagagtttgtgtatattacagacgatacctattccaagaagcag
gttctgagaatggagcacctagtattgaaagtccttgcttttgacttggctgcaccaaca
gtaaatcagttccttacccagtacttcctgcacctgcagcctgcaaactgtaaggttgaa
agcttagcaatgtttttgggagaactgagtttgatagatgctgacccgtaccttaagtac
ctgccttcactcattgctggagctgccttccacttggctctctacacagtcacaggacag
agctggcctgagtcattggcacaacagactggatataccctggagagtcttaagccttgt
cttgtggaccttcaccagacctacctcaaagcgccacaacatgcccaacagtcaatacgg
gaaaagtacaagcattcaaaatatcacagtgtttctcttctcaacccaccagagacacta
agtgtgtga

DBGET integrated database retrieval system