KEGG   Mus musculus (mouse): 12443Help
Entry
12443             CDS       T01002                                 

Gene name
Ccnd1, AI327039, CycD1, Cyl-1, PRAD1, bcl-1, cD1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04371  Apelin signaling pathway
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04630  Jak-STAT signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing's syndrome
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05416  Viral myocarditis
Module
mmu_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    12443 (Ccnd1)
   04340 Hedgehog signaling pathway
    12443 (Ccnd1)
   04390 Hippo signaling pathway
    12443 (Ccnd1)
   04371 Apelin signaling pathway
    12443 (Ccnd1)
   04630 Jak-STAT signaling pathway
    12443 (Ccnd1)
   04068 FoxO signaling pathway
    12443 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    12443 (Ccnd1)
   04152 AMPK signaling pathway
    12443 (Ccnd1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12443 (Ccnd1)
   04115 p53 signaling pathway
    12443 (Ccnd1)
   04218 Cellular senescence
    12443 (Ccnd1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    12443 (Ccnd1)
   04530 Tight junction
    12443 (Ccnd1)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    12443 (Ccnd1)
   04921 Oxytocin signaling pathway
    12443 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    12443 (Ccnd1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12443 (Ccnd1)
   05206 MicroRNAs in cancer
    12443 (Ccnd1)
   05205 Proteoglycans in cancer
    12443 (Ccnd1)
   05203 Viral carcinogenesis
    12443 (Ccnd1)
   05210 Colorectal cancer
    12443 (Ccnd1)
   05212 Pancreatic cancer
    12443 (Ccnd1)
   05225 Hepatocellular carcinoma
    12443 (Ccnd1)
   05226 Gastric cancer
    12443 (Ccnd1)
   05214 Glioma
    12443 (Ccnd1)
   05216 Thyroid cancer
    12443 (Ccnd1)
   05221 Acute myeloid leukemia
    12443 (Ccnd1)
   05220 Chronic myeloid leukemia
    12443 (Ccnd1)
   05218 Melanoma
    12443 (Ccnd1)
   05219 Bladder cancer
    12443 (Ccnd1)
   05215 Prostate cancer
    12443 (Ccnd1)
   05213 Endometrial cancer
    12443 (Ccnd1)
   05224 Breast cancer
    12443 (Ccnd1)
   05222 Small cell lung cancer
    12443 (Ccnd1)
   05223 Non-small cell lung cancer
    12443 (Ccnd1)
  Cardiovascular diseases
   05416 Viral myocarditis
    12443 (Ccnd1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    12443 (Ccnd1)
   04934 Cushing's syndrome
    12443 (Ccnd1)
  Infectious diseases
   05166 HTLV-I infection
    12443 (Ccnd1)
   05162 Measles
    12443 (Ccnd1)
   05161 Hepatitis B
    12443 (Ccnd1)
   05163 Human cytomegalovirus infection
    12443 (Ccnd1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    12443 (Ccnd1)
   05165 Human papillomavirus infection
    12443 (Ccnd1)
  Drug resistance
   01522 Endocrine resistance
    12443 (Ccnd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 12443
NCBI-ProteinID: NP_031657
MGI: 88313
Ensembl: ENSMUSG00000070348
Vega: OTTMUSG00000026018
UniProt: P25322 Q790L7
Position
7 F5; 7 88.92 cM
AA seq 295 aa AA seqDB search
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggagaccatccgccgcgcgtaccctgacacc
aatctcctcaacgaccgggtgctgcgagccatgctcaagacggaggagacctgtgcgccc
tccgtatcttacttcaagtgcgtgcagaaggagattgtgccatccatgcggaaaatcgtg
gccacctggatgctggaggtctgtgaggagcagaagtgcgaagaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtccctggagcccttgaagaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaggagaccattcccttgact
gccgagaagttgtgcatctacactgacaactctatccggcccgaggagctgctgcaaatg
gaactgcttctggtgaacaagctcaagtggaacctggccgccatgactccccacgatttc
atcgaacacttcctctccaaaatgccagaggcggatgagaacaagcagaccatccgcaag
catgcacagacctttgtggccctctgtgccacagatgtgaagttcatttccaacccaccc
tccatggtagctgctgggagcgtggtggctgcgatgcaaggcctgaacctgggcagcccc
aacaacttcctctcctgctaccgcacaacgcactttctttccagagtcatcaagtgtgac
ccggactgcctccgtgcctgccaggaacagattgaagcccttctggagtcaagcctgcgc
caggcccagcagaacgtcgaccccaaggccactgaggaggagggggaagtggaggaagag
gctggtctggcctgcacgcccaccgacgtgcgagatgtggacatctga

DBGET integrated database retrieval system