KEGG   Mus musculus (mouse): 12443
Entry
12443             CDS       T01002                                 

Gene name
Ccnd1, AI327039, CycD1, Cyl-, Cyl-1, PR, PRAD1, bcl-, bcl-1, cD1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04371  Apelin signaling pathway
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu05160  Hepatitis C
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12443 (Ccnd1)
   04340 Hedgehog signaling pathway
    12443 (Ccnd1)
   04390 Hippo signaling pathway
    12443 (Ccnd1)
   04371 Apelin signaling pathway
    12443 (Ccnd1)
   04630 JAK-STAT signaling pathway
    12443 (Ccnd1)
   04068 FoxO signaling pathway
    12443 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    12443 (Ccnd1)
   04152 AMPK signaling pathway
    12443 (Ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12443 (Ccnd1)
   04115 p53 signaling pathway
    12443 (Ccnd1)
   04218 Cellular senescence
    12443 (Ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12443 (Ccnd1)
   04530 Tight junction
    12443 (Ccnd1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    12443 (Ccnd1)
   04921 Oxytocin signaling pathway
    12443 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    12443 (Ccnd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12443 (Ccnd1)
   05206 MicroRNAs in cancer
    12443 (Ccnd1)
   05205 Proteoglycans in cancer
    12443 (Ccnd1)
   05203 Viral carcinogenesis
    12443 (Ccnd1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    12443 (Ccnd1)
   05212 Pancreatic cancer
    12443 (Ccnd1)
   05225 Hepatocellular carcinoma
    12443 (Ccnd1)
   05226 Gastric cancer
    12443 (Ccnd1)
   05214 Glioma
    12443 (Ccnd1)
   05216 Thyroid cancer
    12443 (Ccnd1)
   05221 Acute myeloid leukemia
    12443 (Ccnd1)
   05220 Chronic myeloid leukemia
    12443 (Ccnd1)
   05218 Melanoma
    12443 (Ccnd1)
   05219 Bladder cancer
    12443 (Ccnd1)
   05215 Prostate cancer
    12443 (Ccnd1)
   05213 Endometrial cancer
    12443 (Ccnd1)
   05224 Breast cancer
    12443 (Ccnd1)
   05222 Small cell lung cancer
    12443 (Ccnd1)
   05223 Non-small cell lung cancer
    12443 (Ccnd1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12443 (Ccnd1)
   05160 Hepatitis C
    12443 (Ccnd1)
   05162 Measles
    12443 (Ccnd1)
   05163 Human cytomegalovirus infection
    12443 (Ccnd1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12443 (Ccnd1)
   05169 Epstein-Barr virus infection
    12443 (Ccnd1)
   05165 Human papillomavirus infection
    12443 (Ccnd1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    12443 (Ccnd1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12443 (Ccnd1)
   04934 Cushing syndrome
    12443 (Ccnd1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    12443 (Ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 12443
NCBI-ProteinID: NP_031657
MGI: 88313
Ensembl: ENSMUSG00000070348
Vega: OTTMUSG00000026018
UniProt: P25322 Q790L7
Position
7 F5; 7 88.92 cM
AA seq 295 aa
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggagaccatccgccgcgcgtaccctgacacc
aatctcctcaacgaccgggtgctgcgagccatgctcaagacggaggagacctgtgcgccc
tccgtatcttacttcaagtgcgtgcagaaggagattgtgccatccatgcggaaaatcgtg
gccacctggatgctggaggtctgtgaggagcagaagtgcgaagaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtccctggagcccttgaagaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaggagaccattcccttgact
gccgagaagttgtgcatctacactgacaactctatccggcccgaggagctgctgcaaatg
gaactgcttctggtgaacaagctcaagtggaacctggccgccatgactccccacgatttc
atcgaacacttcctctccaaaatgccagaggcggatgagaacaagcagaccatccgcaag
catgcacagacctttgtggccctctgtgccacagatgtgaagttcatttccaacccaccc
tccatggtagctgctgggagcgtggtggctgcgatgcaaggcctgaacctgggcagcccc
aacaacttcctctcctgctaccgcacaacgcactttctttccagagtcatcaagtgtgac
ccggactgcctccgtgcctgccaggaacagattgaagcccttctggagtcaagcctgcgc
caggcccagcagaacgtcgaccccaaggccactgaggaggagggggaagtggaggaagag
gctggtctggcctgcacgcccaccgacgtgcgagatgtggacatctga

KEGG   Mus musculus (mouse): 12444
Entry
12444             CDS       T01002                                 

Gene name
Ccnd2, 2600016F06Rik, AI256817, BF642806, C86853, V, Vi, Vin-1, Vin1, cD2
Definition
(RefSeq) cyclin D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12444 (Ccnd2)
   04340 Hedgehog signaling pathway
    12444 (Ccnd2)
   04390 Hippo signaling pathway
    12444 (Ccnd2)
   04630 JAK-STAT signaling pathway
    12444 (Ccnd2)
   04068 FoxO signaling pathway
    12444 (Ccnd2)
   04151 PI3K-Akt signaling pathway
    12444 (Ccnd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12444 (Ccnd2)
   04115 p53 signaling pathway
    12444 (Ccnd2)
   04218 Cellular senescence
    12444 (Ccnd2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12444 (Ccnd2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    12444 (Ccnd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12444 (Ccnd2)
   05202 Transcriptional misregulation in cancer
    12444 (Ccnd2)
   05206 MicroRNAs in cancer
    12444 (Ccnd2)
   05203 Viral carcinogenesis
    12444 (Ccnd2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12444 (Ccnd2)
   05162 Measles
    12444 (Ccnd2)
   05169 Epstein-Barr virus infection
    12444 (Ccnd2)
   05165 Human papillomavirus infection
    12444 (Ccnd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 12444
NCBI-ProteinID: NP_033959
MGI: 88314
Ensembl: ENSMUSG00000000184
Vega: OTTMUSG00000056347
UniProt: P30280 Q4FK45
Position
6 F3; 6 61.92 cM
AA seq 289 aa
MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVAT
WMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAE
KLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHA
QTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDDEVNTLTCDALTELLAKITHTDVD
CLKACQEQIEALLLNSLQQFRQEQHNAGSKSVEDPDQATTPTDVRDVDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggacccggtccgcagggccgtgccggaccgcaacctg
ctggaagaccgcgttctgcagaacctgttgaccatcgaggagcgctacctcccgcagtgt
tcctatttcaagtgcgtgcagaaggacatccaaccgtacatgcgcaggatggtggccacc
tggatgctagaggtctgtgaggaacaaaagtgtgaagaagaggtctttcctctggccatg
aattacctggaccgtttcttggctggagtcccgactcctaagacccatcttcagctcctg
ggtgcagtgtgcatgttcctagcttccaagctgaaagagaccatcccgctgactgcggaa
aagctgtgcatttacaccgacaactctgtgaagccccaggagctgctggagtgggaactg
gtagtgttgggtaagctgaagtggaacctggccgcagtcacccctcacgacttcattgag
cacatccttcgcaagctgccccagcaaaaggagaagctgtccctgatccgcaagcatgcg
cagaccttcatcgctctgtgcgctaccgacttcaagtttgccatgtacccgccgtcgatg
attgcaactggaagcgtgggagcagccatctgtgggcttcagcaggatgatgaagtgaac
acactcacgtgtgatgccctgacagagctgctggccaagatcacccacactgatgtggat
tgtctcaaagcctgccaggagcaaatcgaagctctgctgctgaacagcctgcagcagttc
cgtcaagagcagcataacgccggatccaagtctgtggaagatccggaccaagccaccacc
cctacagacgtgcgggatgttgacctgtga

KEGG   Mus musculus (mouse): 12445
Entry
12445             CDS       T01002                                 

Gene name
Ccnd3, 9230106B05Rik, AA682053, AL024085, AW146355, C78795
Definition
(RefSeq) cyclin D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04630  JAK-STAT signaling pathway
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12445 (Ccnd3)
   04390 Hippo signaling pathway
    12445 (Ccnd3)
   04630 JAK-STAT signaling pathway
    12445 (Ccnd3)
   04151 PI3K-Akt signaling pathway
    12445 (Ccnd3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12445 (Ccnd3)
   04115 p53 signaling pathway
    12445 (Ccnd3)
   04218 Cellular senescence
    12445 (Ccnd3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12445 (Ccnd3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12445 (Ccnd3)
   05203 Viral carcinogenesis
    12445 (Ccnd3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12445 (Ccnd3)
   05164 Influenza A
    12445 (Ccnd3)
   05162 Measles
    12445 (Ccnd3)
   05169 Epstein-Barr virus infection
    12445 (Ccnd3)
   05165 Human papillomavirus infection
    12445 (Ccnd3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 12445
NCBI-ProteinID: NP_001075104
MGI: 88315
Ensembl: ENSMUSG00000034165
Vega: OTTMUSG00000044411
UniProt: P30282 Q3TSW4 Q3TWY0
Position
17 C; 17 23.37 cM
AA seq 292 aa
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQKEIKPHMRKML
AYWMLEVCEEQRCEEDVFPLAMNYLDRYLSCVPTRKAQLQLLGTVCLLLASKLRETTPLT
IEKLCIYTDQAVAPWQLREWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPSDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVLGLGACSMSADELTELLAGITGTEVDCL
RACQEQIEAALRESLREAAQTAPSPVPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagctgctgtgttgcgagggcacccggcacgcgccccgggccgggcccgacccgcgg
ctgcttggggaccagcgtgtcctgcagagtttactccgcctggaggagcgctacgtgccg
cgagcctcctacttccagtgcgtgcaaaaggagatcaagccgcacatgcggaagatgctg
gcatactggatgctggaggtgtgtgaggagcagcgctgcgaggaggatgtcttccctctg
gctatgaactacctggatcgctacctgtcctgcgtccccacccgaaaggcgcaattgcag
cttctaggtaccgtctgcctgttgctggcctccaagctgcgcgaaaccacgcccctgact
attgagaagctttgcatctatacggaccaggctgtggctccatggcagttgcgggagtgg
gaggtgctggtcctggggaagctcaagtgggacctggctgccgtgattgcgcacgacttc
ctggccttgattctgcaccgcctgtctctgcccagtgaccggcaggctttggtcaaaaag
catgcccagacctttttggccctctgtgctacagattacacctttgcgatgtatcctcca
tccatgatcgccacaggcagcattggggcagccgtgctaggcctaggcgcctgctctatg
tctgcggatgagctcacagagttgctggccgggatcacaggcactgaagtggactgcctg
cgagcctgccaggaacagatcgaagctgccctcagggagagcctcagggaagctgctcag
acagcccccagcccagtgcccaaagccccccggggctctagcagccaggggcccagtcag
accagcactcccacagatgtcacagccattcacctgtag

KEGG   Mus musculus (mouse): 12447
Entry
12447             CDS       T01002                                 

Gene name
Ccne1, AW538188, CycE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04934  Cushing syndrome
mmu05161  Hepatitis B
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05215  Prostate cancer
mmu05222  Small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12447 (Ccne1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12447 (Ccne1)
   04114 Oocyte meiosis
    12447 (Ccne1)
   04115 p53 signaling pathway
    12447 (Ccne1)
   04218 Cellular senescence
    12447 (Ccne1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12447 (Ccne1)
   05206 MicroRNAs in cancer
    12447 (Ccne1)
   05203 Viral carcinogenesis
    12447 (Ccne1)
  09162 Cancer: specific types
   05226 Gastric cancer
    12447 (Ccne1)
   05215 Prostate cancer
    12447 (Ccne1)
   05222 Small cell lung cancer
    12447 (Ccne1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12447 (Ccne1)
   05161 Hepatitis B
    12447 (Ccne1)
   05162 Measles
    12447 (Ccne1)
   05169 Epstein-Barr virus infection
    12447 (Ccne1)
   05165 Human papillomavirus infection
    12447 (Ccne1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12447 (Ccne1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12447 (Ccne1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12447 (Ccne1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    12447 (Ccne1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    12447 (Ccne1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 12447
NCBI-ProteinID: NP_031659
MGI: 88316
Ensembl: ENSMUSG00000002068
Vega: OTTMUSG00000022262
UniProt: Q61457
Position
7 B3; 7 25.35 cM
AA seq 408 aa
MPRERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQPWD
DNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRIMLN
KEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQHN
IIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLS
PLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAAS
ALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQT
HTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgccaagggagagagactcgacggaccacagcaacatgaaagaagaaggtggctccgac
ctttcagtccgctccagaaaaaggaaggcaaatgtggccgtgtttttgcaagacccagat
gaagaaattgccaagattgacaagactgtgaaaagcgaggatagcagtcagccctgggat
gataattcagcatgcgtggacccctgctctttcatccccacccctaacaaagaagaggac
aatgagcttgaataccccaggactgcatttcagcctcggaaaatcagaccacccagagcc
tccccacttcccgtcttgaattggggcaatagagaagaggtttggaggatcatgttaaac
aaagaaaagacttacctgagagatgagcactttctgcagcgtcatcctctcctgcaggcg
aggatgagagcagttcttctggattggctaatggaggtgtgcgaagtctataagctccac
agagagacgttctacttggcacaggacttctttgatcgttacatggcatcacaacataat
atcataaaaacacttttacagcttattgggatttcagccttatttattgcttcaaaactt
gaggaaatctaccctccaaagttgcaccagtttgcttatgttacagatggcgcttgctcc
ggggatgaaattcttaccatggaattgatgatgatgaaggcccttaagtggcgtctaagc
cctctgaccattgtgtcctggctgaatgtctatgtccaagtggcctatgtcaacgacacg
ggtgaggtgctgatgcctcagtacccacagcaggtcttcgtgcagatcgcagagcttcta
gacctgtgcgtcctggatgttggctgcttagaatttccttatggtgtcctcgctgcttct
gctttgtatcatttctcctcactggagttgatgcagaaggtctcaggttatcagtggtgc
gacatagagaagtgtgtcaaatggatggttccgttcgccatggttatccgggagatggga
agttccaagctcaagcacttccggggagtccccatggaagactcccacaacatccagacc
cacaccaacagcttggatttgctggacaaagcccaagcaaagaaagccatattgtcagaa
cagaataggatttctcctcctccgagtgtggtcctgacacccccacccagcagtaagaag
cagagcagcgagcaggagacagaatga

KEGG   Mus musculus (mouse): 12448
Entry
12448             CDS       T01002                                 

Gene name
Ccne2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04934  Cushing syndrome
mmu05161  Hepatitis B
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05215  Prostate cancer
mmu05222  Small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12448 (Ccne2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12448 (Ccne2)
   04114 Oocyte meiosis
    12448 (Ccne2)
   04115 p53 signaling pathway
    12448 (Ccne2)
   04218 Cellular senescence
    12448 (Ccne2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12448 (Ccne2)
   05206 MicroRNAs in cancer
    12448 (Ccne2)
   05203 Viral carcinogenesis
    12448 (Ccne2)
  09162 Cancer: specific types
   05226 Gastric cancer
    12448 (Ccne2)
   05215 Prostate cancer
    12448 (Ccne2)
   05222 Small cell lung cancer
    12448 (Ccne2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12448 (Ccne2)
   05161 Hepatitis B
    12448 (Ccne2)
   05162 Measles
    12448 (Ccne2)
   05169 Epstein-Barr virus infection
    12448 (Ccne2)
   05165 Human papillomavirus infection
    12448 (Ccne2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12448 (Ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12448 (Ccne2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12448 (Ccne2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    12448 (Ccne2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    12448 (Ccne2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 12448
NCBI-ProteinID: NP_001032211
MGI: 1329034
Ensembl: ENSMUSG00000028212
Vega: OTTMUSG00000004537
UniProt: Q9Z238 Q544H6
Position
4; 4 A1
AA seq 404 aa
MSRRSSRLQAKQHAQPNQPDSPQETQIIQAKKRKTAQDVKKRKEEITKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQK
ENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDV
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCP
VTVISWLNLFLQVDAVKDVPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQTH
TNYLALLNEVNYVNIYRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcaacatgcccagcccaaccagccagac
tctccgcaagaaacccagataattcaggccaagaagagaaaaacagcacaggatgtcaaa
aaaagaaaagaggagatcaccaagaagcatcagtatgagattaggaattgttggccacct
gtactgtctggaggaatcagcccttgcattatcattgaaacaccccataaagaaatagga
acaagtgacttctctagatttacaaattacagatttaaaaatctttttattaatccctca
cctctgccagatttaagctgggcatgttcacaggaggtttggcaaaacatgttacaaaag
gaaaacagatacgtgcatgacaaacattttcaagttctgcattctgacctggaaccacag
atgaggtcaatacttttagactggcttttagaggtttgtgaagtatacactcttcatagg
gagacattttaccttgcccaagacttttttgacagatttatgttgacacaaaaggatgta
aataaaaatatgcttcaactcattgggattacctcattgttcattgcttccaaacttgag
gaaatctacgctcctaaactccaagagtttgcttacgtcactgatggtgcttgcagtgaa
gtagatatcttaaagatggaactcaatatattaaaggctttaaaatgggaactttgtcca
gtaacagtcatctcctggttgaatctttttcttcaagttgatgctgttaaagatgttcct
aaggttcttctacctcaatattctcaggagacgttcatccagatagctcagcttttagat
ctgtgcattctagccatcgactctttagaatttcaatacagaattctggctgctgccgcc
ttatgtcattttacctccattgaagtggttaagaaagcttcaggtttggaatgggatgac
atctcggaatgtgtagactggatggtgccttttgttagtgttgtaaaaagtgtgagtcca
gtgaagctgaagacttttaagaagatacccatggaagatagacacaatatccagacacac
acaaattatttggctttgctgaatgaagtaaactatgtgaacatctacagaaaaggaggg
cagctgtcaccagtgtgtaatggaggcattatgacaccaccaaagagtactgaaaaacca
ccaggaaaacactga

DBGET integrated database retrieval system