KEGG   Mus musculus (mouse): 12444
Entry
12444             CDS       T01002                                 

Gene name
Ccnd2, 2600016F06Rik, AI256817, BF642806, C86853, Vin-1, Vin1, cD2
Definition
(RefSeq) cyclin D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12444 (Ccnd2)
   04340 Hedgehog signaling pathway
    12444 (Ccnd2)
   04390 Hippo signaling pathway
    12444 (Ccnd2)
   04630 JAK-STAT signaling pathway
    12444 (Ccnd2)
   04068 FoxO signaling pathway
    12444 (Ccnd2)
   04151 PI3K-Akt signaling pathway
    12444 (Ccnd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12444 (Ccnd2)
   04115 p53 signaling pathway
    12444 (Ccnd2)
   04218 Cellular senescence
    12444 (Ccnd2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12444 (Ccnd2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    12444 (Ccnd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12444 (Ccnd2)
   05202 Transcriptional misregulation in cancer
    12444 (Ccnd2)
   05206 MicroRNAs in cancer
    12444 (Ccnd2)
   05203 Viral carcinogenesis
    12444 (Ccnd2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12444 (Ccnd2)
   05162 Measles
    12444 (Ccnd2)
   05169 Epstein-Barr virus infection
    12444 (Ccnd2)
   05165 Human papillomavirus infection
    12444 (Ccnd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 12444
NCBI-ProteinID: NP_033959
MGI: 88314
Ensembl: ENSMUSG00000000184
Vega: OTTMUSG00000056347
UniProt: P30280 Q4FK45
Position
6 F3; 6 61.92 cM
AA seq 289 aa
MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVAT
WMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAE
KLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHA
QTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDDEVNTLTCDALTELLAKITHTDVD
CLKACQEQIEALLLNSLQQFRQEQHNAGSKSVEDPDQATTPTDVRDVDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggacccggtccgcagggccgtgccggaccgcaacctg
ctggaagaccgcgttctgcagaacctgttgaccatcgaggagcgctacctcccgcagtgt
tcctatttcaagtgcgtgcagaaggacatccaaccgtacatgcgcaggatggtggccacc
tggatgctagaggtctgtgaggaacaaaagtgtgaagaagaggtctttcctctggccatg
aattacctggaccgtttcttggctggagtcccgactcctaagacccatcttcagctcctg
ggtgcagtgtgcatgttcctagcttccaagctgaaagagaccatcccgctgactgcggaa
aagctgtgcatttacaccgacaactctgtgaagccccaggagctgctggagtgggaactg
gtagtgttgggtaagctgaagtggaacctggccgcagtcacccctcacgacttcattgag
cacatccttcgcaagctgccccagcaaaaggagaagctgtccctgatccgcaagcatgcg
cagaccttcatcgctctgtgcgctaccgacttcaagtttgccatgtacccgccgtcgatg
attgcaactggaagcgtgggagcagccatctgtgggcttcagcaggatgatgaagtgaac
acactcacgtgtgatgccctgacagagctgctggccaagatcacccacactgatgtggat
tgtctcaaagcctgccaggagcaaatcgaagctctgctgctgaacagcctgcagcagttc
cgtcaagagcagcataacgccggatccaagtctgtggaagatccggaccaagccaccacc
cctacagacgtgcgggatgttgacctgtga

DBGET integrated database retrieval system