KEGG   Mus musculus (mouse): 12445
Entry
12445             CDS       T01002                                 

Symbol
Ccnd3, 9230106B05Rik, AA682053, AL024085, AW146355, C78795
Name
(RefSeq) cyclin D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04630  JAK-STAT signaling pathway
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12445 (Ccnd3)
   04390 Hippo signaling pathway
    12445 (Ccnd3)
   04630 JAK-STAT signaling pathway
    12445 (Ccnd3)
   04151 PI3K-Akt signaling pathway
    12445 (Ccnd3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12445 (Ccnd3)
   04115 p53 signaling pathway
    12445 (Ccnd3)
   04218 Cellular senescence
    12445 (Ccnd3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12445 (Ccnd3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12445 (Ccnd3)
   05207 Chemical carcinogenesis - receptor activation
    12445 (Ccnd3)
   05203 Viral carcinogenesis
    12445 (Ccnd3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12445 (Ccnd3)
   05164 Influenza A
    12445 (Ccnd3)
   05162 Measles
    12445 (Ccnd3)
   05169 Epstein-Barr virus infection
    12445 (Ccnd3)
   05165 Human papillomavirus infection
    12445 (Ccnd3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 12445
NCBI-ProteinID: NP_001075104
MGI: 88315
Ensembl: ENSMUSG00000034165
Vega: OTTMUSG00000044411
UniProt: P30282 Q3TSW4 Q3TWY0
Position
17:47815976..47910614
AA seq 292 aa
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQKEIKPHMRKML
AYWMLEVCEEQRCEEDVFPLAMNYLDRYLSCVPTRKAQLQLLGTVCLLLASKLRETTPLT
IEKLCIYTDQAVAPWQLREWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPSDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVLGLGACSMSADELTELLAGITGTEVDCL
RACQEQIEAALRESLREAAQTAPSPVPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagctgctgtgttgcgagggcacccggcacgcgccccgggccgggcccgacccgcgg
ctgcttggggaccagcgtgtcctgcagagtttactccgcctggaggagcgctacgtgccg
cgagcctcctacttccagtgcgtgcaaaaggagatcaagccgcacatgcggaagatgctg
gcatactggatgctggaggtgtgtgaggagcagcgctgcgaggaggatgtcttccctctg
gctatgaactacctggatcgctacctgtcctgcgtccccacccgaaaggcgcaattgcag
cttctaggtaccgtctgcctgttgctggcctccaagctgcgcgaaaccacgcccctgact
attgagaagctttgcatctatacggaccaggctgtggctccatggcagttgcgggagtgg
gaggtgctggtcctggggaagctcaagtgggacctggctgccgtgattgcgcacgacttc
ctggccttgattctgcaccgcctgtctctgcccagtgaccggcaggctttggtcaaaaag
catgcccagacctttttggccctctgtgctacagattacacctttgcgatgtatcctcca
tccatgatcgccacaggcagcattggggcagccgtgctaggcctaggcgcctgctctatg
tctgcggatgagctcacagagttgctggccgggatcacaggcactgaagtggactgcctg
cgagcctgccaggaacagatcgaagctgccctcagggagagcctcagggaagctgctcag
acagcccccagcccagtgcccaaagccccccggggctctagcagccaggggcccagtcag
accagcactcccacagatgtcacagccattcacctgtag

DBGET integrated database retrieval system