KEGG   Mus musculus (mouse): 12452
Entry
12452             CDS       T01002                                 

Gene name
Ccng2
Definition
(RefSeq) cyclin G2
  KO
K10146  cyclin G2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    12452 (Ccng2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    12452 (Ccng2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 12452
NCBI-ProteinID: NP_031661
MGI: 1095734
Ensembl: ENSMUSG00000029385
Vega: OTTMUSG00000026614
UniProt: O08918 Q3TG40 Q5HZK4
Position
5; 5 E2
AA seq 344 aa
MKDLGAKHLAGGEGVQLFGLLNFYLEQEQRYQPREKGLILMEATPENDNTLCSRLRNAKV
EDLRSLTNFFGSGTETFVLAVNILDRFLALMKVKPKHLSCIGVCCFLLAARLAEEEGDVP
PTHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLYHAIVFCHTSERKEIL
SLDKLEAQLKACNCRVVFSKARPSVLALCLLNLEIETIKSVELLEILLLVKKHLKLSDTE
FFYWRELVSKCLAEYSSPRCCKPDLKKLVWIVSRRTAQNLHSSYYSVPELPTIPEGGCFD
GSESEDSGEDMSCGEESLSSSPPSDQECTFFFDFQVAQTLCFPP
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaaggatttgggggccaagcacttggcaggtggcgaaggggttcagcttttcggattg
ttgaacttctacctggaacaagaacagagataccaacctcgggaaaaagggctgatcttg
atggaggctaccccggagaatgataacactttgtgttcaagactgagaaatgccaaagtg
gaagatttaagaagtttaactaacttctttggatctggcactgaaactttcgttctggct
gtcaatattttggatagattcttggcccttatgaaggtgaaaccgaaacacctgtcctgc
attggcgtctgctgctttttgctggccgccaggctggcggaagaagaaggtgacgttccc
cccacgcacgatgtgatccgcatcagtcagtgtaaatgcacagcgtctgacattaaacgc
atggagaaaatcatctcagagaaactgcactatgagctggaagctaccactgccttaaac
tttttgcacttgtaccacgcgattgtattttgtcacacttcagaaaggaaggagattctc
agcctcgataaactcgaagcgcagctgaaagcttgcaactgccgagttgtcttctccaaa
gcaagaccatctgtattagctctgtgccttctcaatttggaaatagaaacgataaaatcc
gtggaactgctggaaattctcttgcttgttaaaaaacatttgaagctcagcgacactgaa
ttcttttactggagggaactggtttctaaatgtctagcagagtattcttcgcctcgctgc
tgcaagcctgatctgaagaagctggtatggattgtttcgcgacgcactgcgcagaacctc
cacagcagctactacagtgttcctgagctgcccactatcccagaggggggttgctttgac
ggaagtgaaagtgaggactctggtgaagacatgagttgtggagaggagagtctcagcagc
tccccacccagcgatcaggagtgcaccttcttctttgacttccaagtggctcagacactg
tgctttccaccatag

DBGET integrated database retrieval system