KEGG   Mus musculus (mouse): 12455Help
Entry
12455             CDS       T01002                                 

Gene name
Ccnt1, 2810478G24Rik, AI115585, CycT1
Definition
(RefSeq) cyclin T1
  KO
K15188  cyclin T
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    12455 (Ccnt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    12455 (Ccnt1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     12455 (Ccnt1)
    Brd4/P-TEFb complex
     12455 (Ccnt1)
    7SK RNP complex
     12455 (Ccnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 12455
NCBI-ProteinID: NP_033963
MGI: 1328363
Ensembl: ENSMUSG00000011960
Vega: OTTMUSG00000035789
UniProt: Q9QWV9
Position
15; 15 F1
AA seq 724 aa AA seqDB search
MEGERKNNNKRWYFTREQLENSPSRRFGVDSDKELSYRQQAANLLQDMGQRLNVSQLTIN
TAIVYMHRFYMIQSFTQFHRYSMAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPD
TRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN
SLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPSRLKRIRNWRAYQAAMKTKPDDRGADENTSEQTILNMISQTSSDTTIAGLM
SMSTASTSAVPSLPSSEESSSSLTSVDMLQGERWLSSQPPFKLEAAQGHRTSESLALIGV
DHSLQQDGSSAFGSQKQASKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY
AAQNLLSHDSHSSVILKMPIESSENPERPFLDKADKSALKMRLPVASGDKAVSSKPEEIK
MRIKVHSAGDKHNSIEDSVTKSREHKEKQRTHPSNHHHHHNHHSHRHSHLQLPAGPVSKR
PSDPKHSSQTSTLAHKTYSLSSTLSSSSSTRKRGPPEETGAAVFDHPAKIAKSTKSSLNF
PFPPLPTMTQLPGHSSDTSGLPFSQPSCKTRVPHMKLDKGPPGANGHNATQSIDYQDTVN
MLHSLLSAQGVQPTQAPAFEFVHSYGEYMNPRAGAISSRSGTTDKPRPPPLPSEPPPPLP
PLPK
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggagggagagaggaagaacaacaacaagcggtggtattttactcgcgagcagctggag
aacagcccgtcgcgtcgctttggcgtggactccgataaagaactctcttaccgccagcag
gcggccaatctcctccaggacatgggacaacgtctgaacgtctcacaactgacgatcaat
actgctatagtatacatgcaccgattctacatgattcagtcttttacacagtttcatcga
tattccatggctccagcagccttgtttctagcagcaaaagtagaagaacaaccaaagaaa
ttggagcatgtcatcaaggtggcacacacttgcctgcacccacaggagtcacttcctgac
acgaggagtgaggcttacctacaacaagttcaagatctggtgattttagagagtataatt
ttgcagaccttagggtttgaactaacaattgatcacccacatacacatgtggtaaagtgc
acccagcttgttcgagcaagcaaggacttagcacagacatcttacttcatggcaaccaac
agcctgcatttgaccacatttagcctgcagtacacacctcctgtggtggcctgtgtctgc
atccatctggcttgcaagtggtccaactgggagatcccagtctcaactgacgggaagcac
tggtgggagtatgttgacgccactgtgaccttggaactgttagatgaattgacacatgaa
tttctacagattctagagaaaactccaagcaggctgaaacgtattcggaattggagggcg
taccaggctgccatgaaaaccaagccagatgaccgaggagcagatgaaaacacgtcggag
cagacaatcctcaatatgatttctcagacctcttcagacacaactatcgcaggattaatg
agcatgtcaactgcgtctacaagtgcagtgccttccctgccttcctctgaggagtcatcg
agcagtctaactagtgtggatatgttgcagggcgagcggtggctgtcttcccaacctccg
tttaaactcgaagctgcccagggtcatcggactagtgagagtttagcacttattggcgtt
gatcattccttgcaacaggatggttccagtgcgtttggttcccagaagcaggcgagcaag
agtgtgccatctgctaaggtttcacttaaggagtaccgtgcaaagcacgcggaagagttg
gctgctcagaagaggcagctggagaacatggaggccaatgtgaagtcacagtatgcgtat
gctgcccagaatctcctgtctcacgacagccattcttcagttattctcaaaatgcccatt
gagagctcagaaaaccctgaacgtccttttctggataaggctgacaaatcagctctgaaa
atgagactccctgtggccagtggggataaagcagtttcttccaagccagaggagataaag
atgcgcattaaagttcactctgcaggggataagcacaattccatagaagacagtgtcacc
aagagccgcgagcacaaggagaagcagaggactcacccgtctaaccaccaccaccatcac
aaccaccactcacacaggcactctcacttacagctgccagccggccccgtgagcaaacgc
ccaagtgatccaaaacacagcagccagacaagcaccttagcacacaaaacctacagcttg
tccagtactttgtcttcttccagctctactcgtaaaaggggtcccccggaagagactggg
gcagcagtatttgatcatccagccaagattgccaagagtactaaatcttccttgaatttc
cccttccccccccttcctacaatgacccagttgcctgggcatagctcagacacaagtggc
ctgcccttttcacagcctagctgtaaaactcgagttcctcatatgaaactggataaaggc
cctcctggggctaatggtcacaacgcaactcagtcaatagattatcaagacactgtgaat
atgctccactccctgcttagtgcccagggggttcagcccacacaggcccctgcatttgaa
tttgtccactcttatggtgaatatatgaatcccagagctggtgccatctcctccagatct
ggcactacagacaaacctcggccaccacccctcccatcagaaccccctccaccacttcca
cctcttcctaagtga

DBGET integrated database retrieval system