KEGG   Mus musculus (mouse): 12458Help
Entry
12458             CDS       T01002                                 

Gene name
Ccr6, CC-CKR-6, CCR-6, Cmkbr6, KY411
Definition
(RefSeq) chemokine (C-C motif) receptor 6
  KO
K04181  C-C chemokine receptor type 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12458 (Ccr6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12458 (Ccr6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    12458 (Ccr6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12458 (Ccr6)
   04050 Cytokine receptors [BR:mmu04050]
    12458 (Ccr6)
   04090 CD molecules [BR:mmu04090]
    12458 (Ccr6)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    12458 (Ccr6)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12458 (Ccr6)
CD molecules [BR:mmu04090]
 Proteins
  12458 (Ccr6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 12458
NCBI-ProteinID: NP_001177262
MGI: 1333797
Ensembl: ENSMUSG00000040899
UniProt: O54689 Q542B6
Position
17; 17 A1
AA seq 367 aa AA seqDB search
MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVV
MTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVN
FNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKK
YELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFMVFCYLFIIKTLVQAQNSK
RHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCSTEKVLAYTRNVAEVLAFLH
CCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYISRQTSETVEND
NASSFTM
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaattccacagagtcctactttggaacggatgattatgacaacacagagtattattct
attcctccagaccatgggccatgctccctagaagaggtcagaaacttcaccaaggtattt
gtgccaattgcctactccttaatatgtgtctttggcctcctgggcaacattatggtggtg
atgacctttgccttctacaagaaagccagatccatgactgacgtctacctgttgaacatg
gccatcacagacatactctttgtcctcaccctaccgttctgggcagttactcatgccacc
aacacttgggttttcagcgatgcactgtgtaaactgatgaaaggcacatatgcggtcaac
tttaactgtgggatgctgctcctggcctgtatcagcatggaccggtacattgccatcgtc
caggcaaccaaatctttccgggtacgctccagaacactgacgcacagtaaggtcatctgt
gtggcagtgtggttcatctccatcatcatctcaagccctacatttatcttcaacaagaaa
tacgagctgcaggatcgtgatgtctgtgagccacggtacaggtctgtctcagagcccatc
acgtggaagctgctgggtatgggactggagctgttctttgggttcttcacccctttgctg
tttatggtgttctgctatctgttcattatcaagaccttggtgcaggcccagaactccaag
aggcacagagcaatccgagtcgtgatcgctgtggttctcgtgttcctggcttgtcagatc
cctcacaacatggtcctcctcgtgactgcggtcaacacgggcaaagtgggccggagctgc
agcaccgagaaagtcctcgcctacaccaggaacgtggccgaggtcctggctttcctgcat
tgctgcctcaaccccgtgttgtatgcgtttattggacagaaattcagaaactacttcatg
aagatcatgaaggatgtgtggtgtatgagaaggaagaataagatgcctggcttcctctgt
gcccgggtttactcggaaagctacatctccaggcagaccagtgagaccgtcgaaaatgat
aatgcatcgtcctttaccatgtaa

DBGET integrated database retrieval system