KEGG   Mus musculus (mouse): 12460Help
Entry
12460             CDS       T01002                                 

Gene name
Ccs, Ccsd
Definition
(RefSeq) copper chaperone for superoxide dismutase
  KO
K04569  copper chaperone for superoxide dismutase
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05014  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    12460 (Ccs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu HMA
Motif
Other DBs
NCBI-GeneID: 12460
NCBI-ProteinID: NP_058588
MGI: 1333783
Ensembl: ENSMUSG00000034108
UniProt: Q9WU84 Q543K2
Position
19 A; 19 4.11 cM
AA seq 274 aa AA seqDB search
MASKSGDGGTVCALEFAVQMSCQSCVDAVHKTLKGVAGVQNVDVQLENQMVLVQTTLPSQ
EVQALLESTGRQAVLKGMGSSQLQNLGAAVAILEGCGSIQGVVRFLQLSSELCLIEGTID
GLEPGLHGLHVHQYGDLTRDCNSCGDHFNPDGASHGGPQDTDRHRGDLGNVRAEAGGRAT
FRIEDKQLKVWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGKRLACGIIARSAGLFQNP
KQICSCDGLTIWEERGRPIAGQGRKDSAQPPAHL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaagtcgggggacggtgggactgtgtgtgcgttggagtttgcagtgcagatg
agttgtcagagctgtgtggatgctgtgcacaagaccctgaaaggggtggcaggtgtccag
aatgtggacgttcagttggagaaccagatggtgttggtgcagacgactctgcccagccag
gaggtacaagcactcctggaaagcacagggaggcaggctgtactcaagggtatgggcagt
agccaattacagaatctgggagcagcagtggccattctggagggctgtggctccatacag
ggggtggtccgcttcctacagctatcctctgaactctgcttgattgagggaaccatcgac
ggcctagagcctgggctgcatggactccatgtgcatcagtatggggaccttacgagggac
tgcaatagctgtggggaccattttaaccctgatggagcatctcatgggggtcctcaggac
actgatcggcaccggggagatctgggcaatgtccgggctgaagctggtggccgagctacc
ttccggatagaggataaacagctgaaggtgtgggatgtgattggccgcagcctggttatc
gatgagggggaagatgacctgggccggggaggccatcccttatccaagatcacagggaat
tctgggaagaggttggcctgtggcatcattgcacgctctgccggccttttccagaacccc
aagcagatctgctcctgtgatggcctcactatctgggaggagcgaggccggcccattgcc
ggtcaaggccgaaaggactcagcccaacccccagctcacctctaa

DBGET integrated database retrieval system