KEGG   Mus musculus (mouse): 12461Help
Entry
12461             CDS       T01002                                 

Gene name
Cct2, Cctb
Definition
(RefSeq) chaperonin containing Tcp1, subunit 2 (beta)
  KO
K09494  T-complex protein 1 subunit beta
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12461 (Cct2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12461 (Cct2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12461 (Cct2)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP60 / Chaperonin
   12461 (Cct2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    12461 (Cct2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12461 (Cct2)
  Exosomal proteins of colorectal cancer cells
   12461 (Cct2)
  Exosomal proteins of bladder cancer cells
   12461 (Cct2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cpn60_TCP1 DUF2529 Ribosomal_S13
Motif
Other DBs
NCBI-GeneID: 12461
NCBI-ProteinID: NP_031662
MGI: 107186
Ensembl: ENSMUSG00000034024
UniProt: P80314 Q542X7
Position
10; 10 D2
AA seq 535 aa AA seqDB search
MASLSLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAA
LMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKK
IHPQTIISGWREATKAAREALLSSAVDHGSDEARFWQDLMNIAGTTLSSKLLTHHKDHFT
KLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIA
NTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYP
EQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLI
HFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHA
VTQLANRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGHITAGLDM
KEGTIGDMAVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcttccctttccctcgcacctgttaatatcttcaaggctggagctgatgaagagagg
gccgagacagctcgcctgtcgtcgtttatcggtgccatcgccattggagacttggtgaag
agcactttgggaccgaagggcatggacaaaattctcctaagcagtggacgagacgccgct
ctgatggtgaccaacgacggtgctaccattctcaagaacattggtgtggacaaccccgca
gcaaaggttctagttgatatgtcaagggttcaagatgatgaagttggtgatggcactacc
tctgttactgtcttagccgcagagctgctccgggaagcagaatctttaattgcaaaaaag
atacatccacagaccatcatctcaggttggagagaagccacaaaggcagcaagagaggcc
ctgctgagctccgctgtggatcatggttctgatgaagccagattctggcaggacttaatg
aacattgcaggaacgacattgtcctcaaagctccttactcaccacaaggaccactttact
aaactggccgtggaagcggttctcagactgaaaggctctggcaacctggaggcgattcat
gtcatcaagaaactaggtgggagtctggcagactcctatctagatgaaggttttcttttg
gataaaaaaattggagtaaatcaaccaaagagaattgaaaatgctaaaattcttattgca
aatactgggatggatacagacaaaataaagatatttggctctcgggtaagagttgattcc
acagcaaaggttgcagagatagaacatgcagaaaaggagaagatgaaggagaaagttgaa
cgtattcttaagcatggaataaattgctttattaacagacagttaatttataattaccct
gaacaactcttcggcgctgctggcgtcatggctattgagcatgcggatttcgcaggtgtg
gagcgcctcgctcttgtcacaggtggtgagattgcctctacctttgatcacccagaactt
gtgaagcttggaagttgcaaacttattgaagaagttatgatcggggaagataaactcatt
cacttttctggggttgcccttggtgaggcatgcaccattgtgcttcgtggtgccactcag
caaattctggatgaagctgaacgatctctgcatgatgctctttgtgttcttgctcagact
gtaaaagatcctagaacagtttacgggggaggctgctctgagatgctgatggcccatgct
gtgacacagcttgccaacagaaccccaggaaaagaagctgtagcaatggagtcgtttgca
aaagccctgagaatgttgccgaccatcatagccgacaatgcgggctatgacagtgcagat
ctggtggcacagctccgagctgctcacagtgaaggccatataactgctggactggatatg
aaggaaggtaccatcggcgatatggcagtactgggtataacagagagttttcaagtgaag
cgacaggttcttctgagtgcggctgaagcagcagaggtgatcctgcgagtggacaacatt
atcaaagcagcaccaaggaaacgtgtccccgatcaccacccctgttaa

DBGET integrated database retrieval system