KEGG   Mus musculus (mouse): 12462Help
Entry
12462             CDS       T01002                                 

Gene name
Cct3, AL024092, Cctg, Tcp1-rs3, TriC-P5
Definition
(RefSeq) chaperonin containing Tcp1, subunit 3 (gamma)
  KO
K09495  T-complex protein 1 subunit gamma
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12462 (Cct3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12462 (Cct3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12462 (Cct3)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP60 / Chaperonin
   12462 (Cct3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    12462 (Cct3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12462 (Cct3)
  Exosomal proteins of colorectal cancer cells
   12462 (Cct3)
  Exosomal proteins of bladder cancer cells
   12462 (Cct3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 12462
NCBI-ProteinID: NP_033966
MGI: 104708
Ensembl: ENSMUSG00000001416
Vega: OTTMUSG00000035166
UniProt: P80318 Q3U4U6
Structure
PDB: 

Position
3 F1; 3 38.79 cM
AA seq 545 aa AA seqDB search
MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMT
NDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPT
VVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAV
KTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVL
LDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLA
QHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYF
TFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH
ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGV
NGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQNRQTGAP
DAGQE
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgatgggccaccgtccagtgctcgtgctcagtcagaacacaaagcgtgaatctggaaga
aaagttcagtctggaaatatcaatgctgcaaagacaattgcagacatcatccggacctgc
ttgggacctaaatctatgatgaagatgcttttggacccaatgggaggcatcgtgatgacc
aatgatggcaatgccattcttcgagagattcaagtccagcatcccgcagcaaagtccatg
attgaaattagcaggacccaggatgaagaggttggagatgggaccacatcagtaattatt
cttgcgggagaaatgctctctgtggctgaacacttcctagagcagcagatgcacccaaca
gtggtgatcagtgcttaccgcatggcactggatgatatgatcagcactctgaagaaaatc
agtactcctgttgatgtcaataaccgtgagatgatgttgagcatcatcaatagctctatt
actacaaaagtcatcagtcggtggtcctccttggcatgcaacattgcactggatgctgtt
aagactgtgcagtttgaagagaatggcagaaaggaaattgacatcaaaaaatatgcaagg
gtagaaaagatacccgggggcatcattgaagactcatgtgtcttacgtggagttatgatt
aacaaggatgtgacccatccaaggatgcgccgctatattaagaatcctcgaattgtgcta
ttggattcttctttggagtacaagaaaggagaaagccagaccgacatcgagattacccgg
gaggaggacttcacgcggatcctgcagatggaggaggagtacatccatcagctgtgtgag
gacatcatccagctgaagcctgacgtggtcatcacagagaagggcatctcagatttagct
cagcactacctcatgcgggccaatgtcacagccattcgtagagtccggaaaacagacaat
aatcgcattgctagagcctgtggggcacggatagtcagccgacctgaggaactgagagaa
gatgatgttggtacaggggcaggcttattggaaatcaagaagattggagatgagtacttt
acattcatcactgactgcaaagacccaaaggcctgcaccattcttcttagaggagccagc
aaagagatactctcggaagtagaacgcaacctccaggatgccatgcaagtgtgccgcaat
gttctactggaccctcagctggtgcctggtggtggagcctctgagatggctgtggctcat
gccttgacagaaaaatctaaggccatgactggtgtggaacaatggccatatagagctgtg
gcccaggcgttagaggtcatccctcggaccttgatccagaattgtggggccagtaccatt
cgtctgcttacctcccttcgggccaagcacacacaggagagttgtgagacctggggtgtg
aatggtgagactggtaccttggtggacatgaaagagctgggtatttgggagccattggct
gtgaagctacaaacgtacaaaacagcagtagagactgcagttctgcttctgcggattgat
gacattgtctctggccacaagaagaagggtgatgaccagaaccggcaaactggtgctcca
gatgctggccaggagtga

DBGET integrated database retrieval system