KEGG   Mus musculus (mouse): 12476Help
Entry
12476             CDS       T01002                                 

Gene name
Cd151, PETA-3, SFA-1, Tspan24
Definition
(RefSeq) CD151 antigen
  KO
K06537  CD151 antigen
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12476 (Cd151)
CD molecules [BR:mmu04090]
 Proteins
  12476 (Cd151)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin DUF4199 CD20 SUR7 Integrase_H2C2 DUF973 LtrA DUF2569 DUF996 DUF373
Motif
Other DBs
NCBI-GeneID: 12476
NCBI-ProteinID: NP_001104519
MGI: 1096360
Ensembl: ENSMUSG00000025510
Vega: OTTMUSG00000060219
UniProt: O35566
Position
7 F5; 7 86.82 cM
AA seq 253 aa AA seqDB search
MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLAT
AYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNT
ELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVV
PDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF
TCCLYRSLKLEHY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaattcaatgagaagaaggcaacatgtggcacagtctgcctcaagtacctgctc
tttacctacaactgctgcttctggctggccggcctggctgtcatggcagtgggcatctgg
acactggccctcaagagtgactacattagtctgctggcctcaagcacttacctagccacg
gcctacatcttagtggtggctggtgttgttgtcatggtgactggagtcctgggctgctgt
gccactttcaaggagcgacggaacctgttacgcttgtacttcatcctgctcctcatcatc
ttcctcctggagatcattgctggcatcctggcctatgtctattatcagcagctgaacaca
gagctcaaggagaatctgaaggacaccatggtcaagagataccaccagtcaggccacgag
ggtgtgagcagcgctgtcgacaagctgcagcaagagttccactgttgtggcagcaacaac
tctcaagactggcaagacagcgagtggatccgctctggtgaggcagacagccgcgtggtt
cctgacagctgctgtaagactatggtagctggctgtggtaagcgggaccatgcctccaac
atctataaagtggagggtggctgtatcactaagctggagaccttcattcaggagcacctg
cgggtcattggggcggtgggcattggcatcgcctgtgtgcaggtcttcggcatgatcttc
acctgctgcttgtaccgaagcctcaagctggaacactactga

DBGET integrated database retrieval system