KEGG   Mus musculus (mouse): 12477Help
Entry
12477             CDS       T01002                                 

Gene name
Ctla4, Cd152, Ctla-4, Ly-56
Definition
(RefSeq) cytotoxic T-lymphocyte-associated protein 4
  KO
K06538  cytotoxic T-lymphocyte-associated protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04660  T cell receptor signaling pathway
mmu05320  Autoimmune thyroid disease
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    12477 (Ctla4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    12477 (Ctla4)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    12477 (Ctla4)
   05320 Autoimmune thyroid disease
    12477 (Ctla4)
CD molecules [BR:mmu04090]
 Proteins
  12477 (Ctla4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set V-set_2 Ig_3
Motif
Other DBs
NCBI-GeneID: 12477
NCBI-ProteinID: NP_033973
MGI: 88556
Ensembl: ENSMUSG00000026011
Vega: OTTMUSG00000002278
UniProt: P09793 Q6GTR6
Structure
PDB: 

Position
1 C2; 1 30.58 cM
AA seq 223 aa AA seqDB search
MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEY
SPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLR
AVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFL
VTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtcttggactccggaggtacaaagctcaactgcagctgccttctaggacttgg
ccttttgtagccctgctcactcttcttttcatcccagtcttctctgaagccatacaggtg
acccaaccttcagtggtgttggctagcagccatggtgtcgccagctttccatgtgaatat
tcaccatcacacaacactgatgaggtccgggtgactgtgctgcggcagacaaatgaccaa
atgactgaggtctgtgccacgacattcacagagaagaatacagtgggcttcctagattac
cccttctgcagtggtacctttaatgaaagcagagtgaacctcaccatccaaggactgaga
gctgttgacacgggactgtacctctgcaaggtggaactcatgtacccaccgccatacttt
gtgggcatgggcaacgggacgcagatttatgtcattgatccagaaccatgcccggattct
gacttcctcctttggatccttgtcgcagttagcttggggttgtttttttacagtttcctg
gtcactgctgtttctttgagcaagatgctaaagaaaagaagtcctcttacaacaggggtc
tatgtgaaaatgcccccaacagagccagaatgtgaaaagcaatttcagccttattttatt
cccatcaactga

DBGET integrated database retrieval system