KEGG   Mus musculus (mouse): 12479
Entry
12479             CDS       T01002                                 

Gene name
Cd1d1, AI747460, CD1.1, Cd1a, Cd1d, Ly-38
Definition
(RefSeq) CD1d1 antigen
  KO
K06448  T-cell surface glycoprotein CD1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
mmu04640  Hematopoietic cell lineage
mmu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12479 (Cd1d1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12479 (Cd1d1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12479 (Cd1d1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12479 (Cd1d1)
CD molecules [BR:mmu04090]
 Proteins
  12479 (Cd1d1)
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I C2-set_2 Ig_3
Other DBs
NCBI-GeneID: 12479
NCBI-ProteinID: NP_031665
MGI: 107674
Ensembl: ENSMUSG00000028076
Vega: OTTMUSG00000024396
UniProt: P11609 A0A0R4J090
Structure
PDB: 

Position
3 F1; 3 37.91 cM
AA seq 336 aa
MRYLPWLLLWAFLQVWGQSEAQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSN
DSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSA
GCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQM
LLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMW
MRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDAR
QAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgcggtacctaccatggctgttgctgtgggcattcctacaggtctggggacaatctgaa
gcccagcaaaagaattacaccttccgctgcctgcagatgtcttcctttgcaaacagaagc
tggtcccgcacagacagcgtggtctggctgggggatctgcagactcaccgttggagtaat
gactcagccaccatcagcttcacgaagccatggtcccagggcaagttgagtaaccagcag
tgggagaagttgcagcatatgtttcaagtctatcgagtcagctttaccagggacatacag
gaattagtcaaaatgatgtcacctaaagaagactatcccattgagatccagctgtctgcg
ggctgtgaaatgtaccctgggaatgcttcggaaagctttttacacgtagcatttcaagga
aaatatgtcgtgagattctggggaacgtcctggcagacagtcccaggggccccatcttgg
ttagacttgcccatcaaagtgctcaacgctgatcaagggacaagtgcaaccgtgcagatg
ctcctgaatgacacctgccccctatttgtccgtggtctcctagaggcagggaagtcagac
ctagagaagcaagagaagccagtggcctggttgtccagtgtccccagctctgcacatggc
cataggcagctggtgtgtcatgtctctggcttctacccaaaacctgtgtgggtgatgtgg
atgcggggtgaccaggagcaacagggtactcacagaggtgatttcctgccaaatgctgat
gagacatggtatcttcaagcaaccctggatgtggaggctggagaggaagctggcctggcc
tgcagggtgaagcacagcagcctaggaggacaggatatcatcctctactgggatgccagg
caagcacccgtgggcctgatcgtcttcatagtactgatcatgctagtggtggtgggtgct
gtagtctactatatctggagaaggagaagcgcttatcaagacatccggtga

DBGET integrated database retrieval system