KEGG   Mus musculus (mouse): 12481Help
Entry
12481             CDS       T01002                                 

Gene name
Cd2, LFA-2, Ly-37, Ly37
Definition
(RefSeq) CD2 antigen
  KO
K06449  T-cell surface glycoprotein CD2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    12481 (Cd2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12481 (Cd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12481 (Cd2)
   04090 CD molecules [BR:mmu04090]
    12481 (Cd2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12481 (Cd2)
CD molecules [BR:mmu04090]
 Proteins
  12481 (Cd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set V-set EphA2_TM SARAF Herpes_gE Rhabdo_glycop LST1 MLANA DUF4381 WBP-1 Ig_2 Mid2
Motif
Other DBs
NCBI-GeneID: 12481
NCBI-ProteinID: NP_038514
MGI: 88320
Ensembl: ENSMUSG00000027863
Vega: OTTMUSG00000007104
UniProt: P08920 Q549Q4
Position
3 F2.2; 3 44.17 cM
AA seq 344 aa AA seqDB search
MKCKFLGSFFLLFSLSGKGADCRDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTL
VAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRI
LERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKC
EAINPVSKESKMEVVNCPEKGLSFYVTVGVGAGGLLLVLLVALFIFCICKRRKRNRRRKD
EELEIKASRTSTVERGPKPHSTPAAAAQNSVALQAPPPPGHHLQTPGHRPLPPGHRTREH
QQKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGDGVSLPPPN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtaaattcctgggtagcttctttctgctcttcagcctttccggcaaaggggcg
gactgcagagacaatgagaccatctggggtgtcttgggtcatggcatcaccctgaacatc
cccaactttcaaatgactgatgatattgatgaggtgcgatgggtaaggaggggcaccctg
gtcgcagagtttaaaaggaagaagccaccttttttgatatcagaaacgtatgaggtctta
gcaaacggatccctgaagataaagaagccgatgatgagaaacgacagtggcacctataat
gtaatggtgtatggcacaaatgggatgactaggctggagaaggacctggacgtgaggatt
ctggagagggtctcaaagcccatgatccactgggaatgccccaacacaaccctgacctgt
gcggtcttgcaagggacagattttgaactgaagctgtatcaaggggaaacactactcaat
agtctcccccagaagaacatgagttaccagtggaccaacctgaacgcaccattcaagtgt
gaggcgataaacccggtcagcaaggagtctaagatggaagttgttaactgtccagagaaa
ggtctgtccttctatgtcacagtgggggtcggtgcaggaggactcctcttggtgctcttg
gtggcgctttttattttctgtatctgcaagaggagaaaacggaacaggaggagaaaagat
gaagagctggaaataaaagcttccagaacaagcactgtggaaaggggccccaagccgcac
tcaaccccagccgcagcagcgcagaattcagtggcgctccaagctcctcctccacctggc
catcacctccagacacctggccatcgtcccttgcctccaggccaccgtacccgtgagcac
cagcagaagaagagacctcctccatcaggcacacagattcaccagcagaaaggccctcct
ttacccagaccccgagttcagccaaaacctccctgtgggagtggagatggtgtttcactg
ccgccccctaattaa

DBGET integrated database retrieval system