KEGG   Mus musculus (mouse): 12483
Entry
12483             CDS       T01002                                 

Gene name
Cd22, A530093D23, Lyb, Lyb-, Lyb-8, Lyb8
Definition
(RefSeq) CD22 antigen
  KO
K06467  CD22 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04640  Hematopoietic cell lineage
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12483 (Cd22)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12483 (Cd22)
   04662 B cell receptor signaling pathway
    12483 (Cd22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12483 (Cd22)
   04091 Lectins [BR:mmu04091]
    12483 (Cd22)
CD molecules [BR:mmu04090]
 Proteins
  12483 (Cd22)
Lectins [BR:mmu04091]
 I-type lectins (Siglecs)
  12483 (Cd22)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig I-set V-set Ig_4 C1-set C2-set_2 Ig_5 Ig_6
Other DBs
NCBI-GeneID: 12483
NCBI-ProteinID: NP_001036782
MGI: 88322
Ensembl: ENSMUSG00000030577
Vega: OTTMUSG00000049771
UniProt: P35329 Q3UP36
Position
7 B1; 7 19.26 cM
AA seq 868 aa
MRVHYLWLLLILGHVASARYSSANDWTVDHPQTLFAWEGACIRIPCKYKTPLPKARLDNI
LLFQNYEFDKATKKFTGTVLYNATKTEKDPESELYLSKQGRVTFLGNRIDNCTLKIHPIR
ANDSGNLGLRMTAGTERWMEPIHLNVSEKPFQPYIQMPSEIRESQSVTLTCGLNFSCFGY
DILLKWFLEDSEITSITSSVTSITSSVTSSIKNVYTESKLTFQPKWTDHGKSVKCQVQHS
SKVLSERTVRLDVKYTPKLEIKVNPTEVEKNNSVTMTCRVNSSNPKLRTVAVSWFKDGRP
LEDQELEQEQQMSKLILHSVTKDMRGKYRCQASNDIGPGESEEVELTVHYAPEPSRVHIY
PSPAEEGQSVELICESLASPSATNYTWYHNRKPIPGDTQEKLRIPKVSPWHAGNYSCLAE
NRLGHGKIDQEAKLDVHYAPKAVTTVIQSFTPILEGDSVTLVCRYNSSNPDVTSYRWNPQ
GSGSVLKPGVLRIQKVTWDSMPVSCAACNHKCSWALPVILNVHYAPRDVKVLKVSPASEI
RAGQRVLLQCDFAESNPAEVRFFWKKNGSLVQEGRYLSFGSVSPEDSGNYNCMVNNSIGE
TLSQAWNLQVLYAPRRLRVSISPGDHVMEGKKATLSCESDANPPISQYTWFDSSGQDLHS
SGQKLRLEPLEVQHTGSYRCKGTNGIGTGESPPSTLTVYYSPETIGKRVALGLGFCLTIC
ILAIWGMKIQKKWKQNRSQQGLQENSSGQSFFVRNKKARRTPLSEGPQSQGCYNPAMDDT
VSYAILRFPESDTHNTGDAGTPATQAPPPNNSDSVTYSVIQKRPMGDYENVNPSCPEDES
IHYSELVQFGAGKRPQAKEDVDYVTLKH
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgcgcgtccattacctgtggctcctcttgatcctaggacacgtggcttcggctcggtac
agctcagcaaatgattggaccgttgaccatccccaaaccctctttgcctgggagggagcc
tgcatcaggattccttgcaagtacaaaactccactacccaaggcacgtctggacaacatc
ctcctttttcagaactatgagtttgacaaggccaccaagaaattcacaggaactgtcctg
tacaacgccacaaagactgagaaggacccagagtctgagctgtacctttctaagcaaggg
agagtaacatttctggggaacagaatagacaattgtaccctgaaaatccacccgatacgt
gccaatgacagtgggaatctggggttgaggatgaccgcagggactgaacgatggatggag
cccattcacctcaatgtctcggagaaaccgttccaaccttacatccagatgccatcagaa
atccgggaatcccaaagtgtcactctgacctgtggactgaatttctcctgctttgggtat
gacatcctcttgaagtggttcctagaagattctgagatcacctccatcacctcttctgtc
acctccatcacctcttctgtcacctcctccattaagaatgtctatacagagagcaagctc
accttccaaccaaagtggacggaccacggaaagagtgtgaagtgccaagtccagcactcc
tccaaagtgctctcagagcgcactgtgcgtctggatgttaagtataccccgaagctggag
atcaaggtcaatcccacagaggtggaaaagaacaattctgtgaccatgacatgccgggtt
aacagcagcaacccgaaactcaggaccgtggcggtgtcttggttcaaggatgggcgcccc
ctagaggatcaggaactggaacaggaacaacagatgtccaagctaattctgcattcagtg
accaaggacatgagagggaaataccggtgccaggcttccaacgacataggcccaggagag
tcggaagaagtggaactcacggtgcactatgctccagaaccctccagggttcacatctac
ccttcccccgctgaagagggacagtcagtagagctgatttgtgagtcactggccagtcca
agtgcaacaaactacacctggtatcacaacaggaaacctatacctggagacacccaagag
aagctccgcatccctaaagtctccccgtggcatgctgggaattactcttgcttggcagag
aaccgtctgggtcatggaaagatagaccaggaagctaagctggatgtccattatgctccc
aaggcggtgaccacagtgattcagagcttcacaccaatcctggaaggagacagtgtgacc
ctggtctgtaggtacaactccagcaatccagacgtcacctcctacagatggaaccctcaa
ggttctgggagtgtgctcaaacccggagtgctgaggattcagaaagtgacatgggattcc
atgcctgtcagctgtgctgcctgcaaccacaagtgttcgtgggccctccctgtcatcctg
aatgtccactacgcccccagagacgtgaaggtactgaaggtaagccccgcatcagagatc
cgcgctgggcagcgtgtcctcctccaatgcgacttcgcagagagcaacccggcagaggtc
cgcttcttctggaagaagaatgggagtctcgtgcaggaagggaggtacctgagcttcggc
tccgtctccccagaagattctggaaattataactgcatggtcaacaactccatcggagag
accttgtcacaggcctggaacctccaagtgctgtatgctcctcggaggctgcgtgtgtcc
atcagccctggggaccatgtgatggaggggaagaaggccaccttgtcctgtgagagtgat
gccaatccgcccatctcacagtacacctggtttgactccagtggccaagacctccactcc
tcaggccagaaactgagactggaacccctggaggtccaacacacgggttcctaccgctgc
aaagggaccaatgggataggcacaggagagtcaccacccagcaccctcactgtctactac
agtccagagaccatcggcaagcgggtcgccttgggactaggcttctgcctgactatctgc
atcctggccatctgggggatgaaaatccagaaaaaatggaagcaaaaccgcagccagcag
gggcttcaggaaaattccagtggccagagcttttttgtgaggaacaaaaaggctaggagg
acccctctctcagaaggcccccaatcccagggatgctacaatccggcaatggatgacacc
gttagttatgccatcttgcgctttccagagagtgacacgcacaacactggagatgcaggg
accccagcaacacaggctcctcctccaaacaacagcgactcggtcacttactcggtgata
cagaagcggcctatgggggattatgagaatgtgaatccgagctgcccggaggatgagagc
atccattactcagagctggttcagtttggggctggtaagcggccccaggcaaaggaagac
gtagactatgtgaccctcaagcactga

DBGET integrated database retrieval system