KEGG   Mus musculus (mouse): 12487
Entry
12487             CDS       T01002                                 

Gene name
Cd28
Definition
(RefSeq) CD28 antigen
  KO
K06470  CD28 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04660  T cell receptor signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05162  Measles
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05320  Autoimmune thyroid disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12487 (Cd28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    12487 (Cd28)
   04672 Intestinal immune network for IgA production
    12487 (Cd28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12487 (Cd28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12487 (Cd28)
   05323 Rheumatoid arthritis
    12487 (Cd28)
   05320 Autoimmune thyroid disease
    12487 (Cd28)
   05330 Allograft rejection
    12487 (Cd28)
   05332 Graft-versus-host disease
    12487 (Cd28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    12487 (Cd28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    12487 (Cd28)
  09172 Infectious disease: viral
   05162 Measles
    12487 (Cd28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12487 (Cd28)
CD molecules [BR:mmu04090]
 Proteins
  12487 (Cd28)
SSDB
Motif
Pfam: V-set_2 V-set Raffinose_syn Ly49
Other DBs
NCBI-GeneID: 12487
NCBI-ProteinID: NP_031668
MGI: 88327
Ensembl: ENSMUSG00000026012
Vega: OTTMUSG00000002254
UniProt: P31041 Q8CDB3
Structure
PDB: 
2NAE

Position
1 C2; 1 30.52 cM
AA seq 218 aa
MTLRLLFLALNFFSVQVTENKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGV
NSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYP
PPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNSR
RNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP
NT seq 657 nt   +upstreamnt  +downstreamnt
atgacactcaggctgctgttcttggctctcaacttcttctcagttcaagtaacagaaaac
aagattttggtaaagcagtcgcccctgcttgtggtagatagcaacgaggtcagcctcagc
tgcaggtattcctacaaccttctcgcaaaggaattccgggcatccctgtacaagggcgtg
aacagcgacgtggaagtctgtgtcgggaatgggaattttacctatcagccccagtttcgc
tcgaatgccgagttcaactgcgacggggatttcgacaacgaaacagtgacgttccgtctc
tggaatctgcacgtcaatcacacagatatttacttctgcaaaattgagttcatgtaccct
ccgccttacctagacaacgagaggagcaatggaactattattcacataaaagagaaacat
ctttgtcatactcagtcatctcctaagctgttttgggcactggtcgtggttgctggagtc
ctgttttgttatggcttgctagtgacagtggctctttgtgttatctggacaaatagtaga
aggaacagactccttcaaagtgactacatgaacatgactccccggaggcctgggctcact
cgaaagccttaccagccctacgcccctgccagagactttgcagcgtaccgcccctga

DBGET integrated database retrieval system