KEGG   Mus musculus (mouse): 12489
Entry
12489             CDS       T01002                                 

Gene name
Cd33, Siglec-3, gp67
Definition
(RefSeq) CD33 antigen
  KO
K06473  CD33 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12489 (Cd33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12489 (Cd33)
   04091 Lectins [BR:mmu04091]
    12489 (Cd33)
CD molecules [BR:mmu04090]
 Proteins
  12489 (Cd33)
Lectins [BR:mmu04091]
 I-type lectins (Siglecs)
  12489 (Cd33)
SSDB
Motif
Pfam: V-set ig Ig_3 C2-set C2-set_2 DUF4843 I-set
Other DBs
NCBI-GeneID: 12489
NCBI-ProteinID: NP_001104528
MGI: 99440
Ensembl: ENSMUSG00000004609
Vega: OTTMUSG00000058533
UniProt: Q63994
Position
7 B3; 7 28.25 cM
AA seq 403 aa
MLWPLPLFLLCAGSLAQDLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWL
RKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVV
REPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWM
STALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSGQMRE
LVLVAVGEATVKLLILGLCLVFLIVMFCRRKTTKLSVHMGCENPIKRQEAITSYNHCLSP
TASDAVTPGCSIHRLISRTPRCTAILRIQDPYRRTHLRNRAVSTLRFPWISWEGSLRSTQ
RSKCTKLCSPVKNLCPLWLPVDNSCIPLIPEWVMLLCVSLTLS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgctgtggccactgccgctgttcttgctgtgtgcaggctccctggctcaggatttagaa
ttccagctggtggcgcccgagtcagtgacagtcgaggagggcctatgtgtccatgtgccc
tgcagtgttttctacccctccattaagctcactttaggacctgtgaccggctcctggctc
cggaaaggggtcagtctccatgaagactctccagtggccacaagtgaccccagacaacta
gtgcagaaggcaacacagggcagattccaactccttggggacccacagaaacatgactgt
tccctgttcatcagagatgcacagaaaaatgacacaggaatgtacttcttcagagtggtc
agagaaccttttgtgagatattcttacaaaaaaagccagctgtcactgcatgtgacctct
ctatcacggactcctgacattataatcccggggaccctggaggctggctatcctagcaat
ctcacctgctctgtgccctgggcttgtgagcaggggacaccccctactttctcctggatg
tcaactgccctcacctccttgagttcccgaaccacagactcctccgtgctgacgttcaca
cctcagcctcaggaccatggtaccaaactcacctgcttggtgaccttctctggagcaggt
gtcactgtggaaaggaccatccagctcaatgttacccggaaatcaggccagatgagagag
ctggtcctggtggctgtgggggaggcaacggtcaagctcctgattcttgggctctgtctc
gtgtttctcattgtgatgttctgcagaaggaagacaacaaagctgtcagtgcacatgggc
tgtgaaaatcctatcaagaggcaggaagcgatcacatcctataatcactgcctatctcca
actgcatctgatgctgtgactccaggatgttccatacacaggctcatcagcaggactcca
aggtgcacagcaatcctgagaatccaagacccttacagaaggactcacctcaggaacaga
gcagtgtccacactaagatttccttggatttcatgggagggaagcctcaggagtactcag
agatctaaatgcaccaagctttgctctcctgtgaagaacctgtgtcctctatggcttcct
gtggataattcctgcatccctctgatcccagagtgggttatgctgctgtgtgtgagtctt
acactcagttga

DBGET integrated database retrieval system