KEGG   Mus musculus (mouse): 12491
Entry
12491             CDS       T01002                                 

Gene name
Cd36, FA, FAT, GPIV, Sca, Scarb3
Definition
(RefSeq) CD36 molecule
  KO
K06259  CD36 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04145  Phagosome
mmu04152  AMPK signaling pathway
mmu04512  ECM-receptor interaction
mmu04640  Hematopoietic cell lineage
mmu04920  Adipocytokine signaling pathway
mmu04931  Insulin resistance
mmu04975  Fat digestion and absorption
mmu04979  Cholesterol metabolism
mmu05144  Malaria
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    12491 (Cd36)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12491 (Cd36)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    12491 (Cd36)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12491 (Cd36)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    12491 (Cd36)
   03320 PPAR signaling pathway
    12491 (Cd36)
  09154 Digestive system
   04975 Fat digestion and absorption
    12491 (Cd36)
   04979 Cholesterol metabolism
    12491 (Cd36)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    12491 (Cd36)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12491 (Cd36)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    12491 (Cd36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12491 (Cd36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12491 (Cd36)
   04090 CD molecules [BR:mmu04090]
    12491 (Cd36)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    12491 (Cd36)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   12491 (Cd36)
CD molecules [BR:mmu04090]
 Proteins
  12491 (Cd36)
SSDB
Motif
Pfam: CD36 PorA
Other DBs
NCBI-GeneID: 12491
NCBI-ProteinID: NP_001153027
MGI: 107899
Ensembl: ENSMUSG00000002944
Vega: OTTMUSG00000053047
UniProt: Q08857 Q3UAI3 Q8C6Z4
Position
5 A3; 5 8.11 cM
AA seq 472 aa
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDMLIEKTIKREVVLEEGTTAFKNWVKTGTT
VYRQFWIFDVQNPDDVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGA
IFEPSLSVGTEDDNFTVLNLAVAAAPHIYQNSFVQVVLNSLIKKSKSSMFQTRSLKELLW
GYKDPFLSLVPYPISTTVGVFYPYNDTVDGVYKVFNGKDNISKVAIIESYKGKRNLSYWP
SYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEIDLKGIPVYRFVLPANAF
ASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGL
HPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETG
TIGDEKAEMFKTQVTGKIKLLGMVEMALLGIGVVMFVAFMISYCACKSKNGK
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgggctgtgatcggaactgtgggctcattgctggagctgttattggtgcagtcctggct
gtgtttggaggcattctcatgccagtcggagacatgcttattgagaagacaatcaaaagg
gaagttgtccttgaagaaggaaccactgctttcaaaaactgggttaaaacaggcaccact
gtgtacagacagttttggatctttgatgtgcaaaacccagatgacgtggcaaagaacagc
agcaaaatcaaggttaaacaaagaggtccttacacatacagagttcgttatctagccaag
gaaaatataactcaggaccccgaggaccacactgtgtcttttgtacagcccaatggagcc
atctttgagccttcactgtctgttggaacagaggatgacaacttcacagttctgaatctg
gctgtagcagctgcaccacatatctaccaaaattcatttgttcaagttgtgctcaactct
cttataaaaaagtccaagtcttctatgttccaaacaagatctttgaaagaactcttgtgg
ggttacaaagatccattcctcagtttggttccatatcctataagtaccacagttggtgtg
ttttatccttacaatgacactgtagatggagtttataaagttttcaatggaaaggataac
ataagcaaagttgccataattgagtcctataaagggaaaaggaatttgtcctattggcca
agctattgcgacatgattaatggcacagacgcagcctcctttccaccttttgttgaaaag
tctcggacattgagattcttttcctctgacatttgcaggtctatctacgctgtgttcgga
tctgaaatcgaccttaaaggaatccccgtgtacagatttgttcttccagccaatgccttt
gcatcacccctccagaatccagacaaccattgtttctgcactgaaaaagtaatctccaat
aactgtacatcttatggtgtgctagacattggcaaatgcaaagaaggaaagcctgtgtat
atttcgcttccacatttcctacatgcaagtccagatgtttcagaacctattgaaggctta
catccaaatgaagatgagcataggacatacttagatgtggaacccataactggattcact
ctacaatttgcaaaacgactgcaggtcaacatattggtcaagccagctagaaaaatagaa
gcattaaagaatctgaagagaccttacattgtacctatactgtggctaaatgagactggg
accattggtgatgaaaaagcagaaatgttcaaaacacaagtgactgggaaaatcaagctc
cttggcatggtagagatggccttacttgggattggagtggtgatgtttgttgcttttatg
atttcatattgtgcttgcaaatccaagaatggaaaataa

DBGET integrated database retrieval system