KEGG   Mus musculus (mouse): 12492Help
Entry
12492             CDS       T01002                                 

Gene name
Scarb2, 9330185J12Rik, Cd36l2, LGP85, LIMP_II, LIMP-2, MLGP85
Definition
(RefSeq) scavenger receptor class B, member 2
  KO
K12384  lysosome membrane protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    12492 (Scarb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD36
Motif
Other DBs
NCBI-GeneID: 12492
NCBI-ProteinID: NP_031670
MGI: 1196458
Ensembl: ENSMUSG00000029426
Vega: OTTMUSG00000055604
UniProt: O35114
Position
5; 5 E2
AA seq 478 aa AA seqDB search
MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQTIEKNMVLQNGTKVFNSWEKPPLPV
YIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANIQFGENGTTISAVTNKAYVFE
RNQSVGDPNVDLIRTINIPLLTVVDLAQLTLLRELIEAMLKAYQQKLFVIHTVHELLWGY
KDEILSLVHIFKPDVSPNFGLFYERNGTNDGEYVFLTGEDNYLNFSKIVEWNGKTSLDWW
TTDTCNMINGTDGDSFHPLISKDEVLYLFPSDLCRSVHITFSSFENVEGLPAFRYKVPAE
ILANTSENAGFCIPEGNCMDSGVLNISICKNGAPIIMSFPHFYQADEKFVSAIKGMHPNK
EEHESFVDINPLTGIILRGAKRFQINTYVRKLDDFVETGDIRTMVFPVMYLNESVLIDKE
TANQLKSVINTTLVVTNIPYIIMALGVFFGLVFTWLACRGQGSMDEGTADERAPLIRT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgggcagatgctgcttctacacggcggggacgctgtctctgctgctgctggtgaccagc
gtcacgctgctagtggctcgagtctttcagaaggcggtagaccagacgatcgagaagaat
atggtattacaaaatggcaccaaggtctttaattcctgggagaagccccctctacctgtg
tacatccagttttatttcttcaatgtcaccaatcctgaggagatcctccaaggagaaatc
cccctactagaagaagtggggccatacacctacagggagctccggaacaaggcaaatatt
cagtttggagaaaatggaacaactatatctgctgtcaccaataaggcatatgtttttgaa
cgaaaccaatctgttggagatcctaacgttgacttgattagaacaataaatattcctctg
ttgactgtcgtggatctggcccagctgaccctgctcagggagcttatcgaagccatgctg
aaagcctatcagcagaagttgtttgtgattcacaccgtgcacgaactgctctggggctac
aaagatgagatcttgtccctcgtccatattttcaaacctgacgtctccccgaatttcggc
ctgttctatgagagaaatggaacgaatgacggggagtacgtgtttctgactggagaggac
aattaccttaacttttcaaaaatcgtggagtggaatggaaaaacgtcgctggactggtgg
accacagacacatgcaatatgattaacgggacagacggagactcttttcatccgctgata
agcaaggatgaggtcctgtacctcttcccgtcagacttgtgcaggtcagtacatatcact
ttcagcagctttgagaacgtagaaggactgcctgcttttcggtataaggtgcctgcagaa
atactagccaacacctccgaaaacgctggcttctgtatacccgagggaaactgcatggac
tcaggggtgttgaacatcagcatctgcaagaatggtgcacccattatcatgtctttccca
cacttttaccaagccgacgagaagttcgtttctgccataaaaggcatgcatcccaacaag
gaagagcatgagtcgtttgtggacattaatcccttgactggaattattttgagaggggcc
aagagattccagatcaacacttacgttaggaaactggatgactttgttgaaacgggagac
atcaggactatggttttcccagtgatgtatctcaatgagagtgtcctcattgacaaagag
accgcaaatcaactgaagtctgtgattaacacgactttggttgtcaccaacataccctac
atcattatggcactgggtgtgttctttggcttggttttcacgtggctggcgtgtcgagga
caggggtctatggatgagggaactgcagatgaaagagcacccctcatacgaacctaa

DBGET integrated database retrieval system