KEGG   Mus musculus (mouse): 12493Help
Entry
12493             CDS       T01002                                 

Gene name
Cd37, Tspan26
Definition
(RefSeq) CD37 antigen
  KO
K06475  CD37 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12493 (Cd37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12493 (Cd37)
   04090 CD molecules [BR:mmu04090]
    12493 (Cd37)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12493 (Cd37)
CD molecules [BR:mmu04090]
 Proteins
  12493 (Cd37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspannin
Motif
Other DBs
NCBI-GeneID: 12493
NCBI-ProteinID: NP_031671
MGI: 88330
Ensembl: ENSMUSG00000030798
Vega: OTTMUSG00000025381
UniProt: Q61470 Q4FK35
Position
7 B3; 7 29.2 cM
AA seq 281 aa AA seqDB search
MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVSFVGLSFVPLQTWSKV
LAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQ
ELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCS
CYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHN
NIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccaagagagttgcctcagcctcatcaagtacttcctcttcgttttcaacctc
ttcttctttgtactaggcggcctgattttctgcttcggcacctggatcctcattgacaag
accagcttcgtgtcctttgtgggtttgtccttcgtgccactgcagacttggtccaaggtc
ctggctgtctcaggtgtcctcaccatggccctggctctcctgggctgtgtgggggctcta
aaggagctgcgctgtctcctgggcctgtattttggaatgctgctgctcctgtttgccaca
cagattaccctgggcatcctcatttccactcagcgggtccggctggagcgaagggtgcag
gaattggtgttgaggacgatccagagctaccgcacgaatccggatgagacagcagccgag
gagagttgggactatgcacagttccagctgcgctgctgcggctggcaatctccgcgggac
tggaacaaggcccagatgctgaaagcgaacgagtctgaggagccctttgtgccctgctcc
tgctacaactccacggcgaccaatgactccaccgtctttgataagctctttttctcccag
ctaagccggttggggccgcgggcgaagctgaggcagactgctgacatatgtgcactccct
gcaaaagctcacatctaccgtgagggctgcgcgcagagcctccagaagtggctgcacaac
aatatcatctccatagtgggaatctgtctgggagtcggtcttcttgagctcggcttcatg
acgctctcaatattcctgtgtagaaatctggatcacgtctatgaccggctggcccggtac
cgctag

DBGET integrated database retrieval system