KEGG   Mus musculus (mouse): 12500Help
Entry
12500             CDS       T01002                                 

Gene name
Cd3d, T3d
Definition
(RefSeq) CD3 antigen, delta polypeptide
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease (American trypanosomiasis)
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12500 (Cd3d)
   04660 T cell receptor signaling pathway
    12500 (Cd3d)
   04658 Th1 and Th2 cell differentiation
    12500 (Cd3d)
   04659 Th17 cell differentiation
    12500 (Cd3d)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    12500 (Cd3d)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    12500 (Cd3d)
   05170 Human immunodeficiency virus 1 infection
    12500 (Cd3d)
   05162 Measles
    12500 (Cd3d)
   05169 Epstein-Barr virus infection
    12500 (Cd3d)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    12500 (Cd3d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12500 (Cd3d)
CD molecules [BR:mmu04090]
 Proteins
  12500 (Cd3d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_4 ITAM Ig_5
Motif
Other DBs
NCBI-GeneID: 12500
NCBI-ProteinID: NP_038515
MGI: 88331
Ensembl: ENSMUSG00000032094
Vega: OTTMUSG00000063397
UniProt: P04235 Q3U4T1 Q3V3B4 Q6P5P1
Position
9 A5.2; 9 24.84 cM
AA seq 173 aa AA seqDB search
MEHSGILASLILIAVLPQGSPFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNL
GKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLAL
GVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggaacacagcgggattctggctagtctgatactgattgctgttctcccccaagggagc
cccttcaagatacaagtgaccgaatatgaggacaaagtatttgtgacctgcaataccagc
gtcatgcatctagatggaacggtggaaggatggtttgcaaagaataaaacactcaacttg
ggcaaaggcgttctggacccacgagggatatatctgtgtaatgggacagagcagctggca
aaggtggtgtcttctgtgcaagtccattaccgaatgtgccagaactgtgtggagctagac
tcgggcaccatggctggtgtcatcttcattgacctcatcgcaactctgctcctggctttg
ggcgtctactgctttgcaggacatgagaccggaaggccttctggggctgctgaggttcaa
gcactgctgaagaatgagcagctgtatcagcctcttcgagatcgtgaagatacccagtac
agccgtcttggagggaactggccccggaacaagaaatcttaa

DBGET integrated database retrieval system