KEGG   Mus musculus (mouse): 12500
Entry
12500             CDS       T01002                                 

Gene name
Cd3d, T3d
Definition
(RefSeq) CD3 antigen, delta polypeptide
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12500 (Cd3d)
   04660 T cell receptor signaling pathway
    12500 (Cd3d)
   04658 Th1 and Th2 cell differentiation
    12500 (Cd3d)
   04659 Th17 cell differentiation
    12500 (Cd3d)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12500 (Cd3d)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12500 (Cd3d)
   05170 Human immunodeficiency virus 1 infection
    12500 (Cd3d)
   05162 Measles
    12500 (Cd3d)
   05169 Epstein-Barr virus infection
    12500 (Cd3d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12500 (Cd3d)
  09163 Immune disease
   05340 Primary immunodeficiency
    12500 (Cd3d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12500 (Cd3d)
CD molecules [BR:mmu04090]
 Proteins
  12500 (Cd3d)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5
Other DBs
NCBI-GeneID: 12500
NCBI-ProteinID: NP_038515
MGI: 88331
Ensembl: ENSMUSG00000032094
Vega: OTTMUSG00000063397
UniProt: P04235 Q3U4T1 Q3V3B4 Q6P5P1
Position
9 A5.2; 9 24.84 cM
AA seq 173 aa
MEHSGILASLILIAVLPQGSPFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNL
GKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLAL
GVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS
NT seq 522 nt   +upstreamnt  +downstreamnt
atggaacacagcgggattctggctagtctgatactgattgctgttctcccccaagggagc
cccttcaagatacaagtgaccgaatatgaggacaaagtatttgtgacctgcaataccagc
gtcatgcatctagatggaacggtggaaggatggtttgcaaagaataaaacactcaacttg
ggcaaaggcgttctggacccacgagggatatatctgtgtaatgggacagagcagctggca
aaggtggtgtcttctgtgcaagtccattaccgaatgtgccagaactgtgtggagctagac
tcgggcaccatggctggtgtcatcttcattgacctcatcgcaactctgctcctggctttg
ggcgtctactgctttgcaggacatgagaccggaaggccttctggggctgctgaggttcaa
gcactgctgaagaatgagcagctgtatcagcctcttcgagatcgtgaagatacccagtac
agccgtcttggagggaactggccccggaacaagaaatcttaa

KEGG   Mus musculus (mouse): 12501
Entry
12501             CDS       T01002                                 

Gene name
Cd3e, AI504783, CD3, CD3epsilon, T3e
Definition
(RefSeq) CD3 antigen, epsilon polypeptide
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12501 (Cd3e)
   04660 T cell receptor signaling pathway
    12501 (Cd3e)
   04658 Th1 and Th2 cell differentiation
    12501 (Cd3e)
   04659 Th17 cell differentiation
    12501 (Cd3e)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12501 (Cd3e)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12501 (Cd3e)
   05170 Human immunodeficiency virus 1 infection
    12501 (Cd3e)
   05162 Measles
    12501 (Cd3e)
   05169 Epstein-Barr virus infection
    12501 (Cd3e)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12501 (Cd3e)
  09163 Immune disease
   05340 Primary immunodeficiency
    12501 (Cd3e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12501 (Cd3e)
CD molecules [BR:mmu04090]
 Proteins
  12501 (Cd3e)
SSDB
Motif
Pfam: Ig_5 Ig_4 Ig_2 ITAM Ig_3 ig V-set I-set
Other DBs
NCBI-GeneID: 12501
NCBI-ProteinID: NP_031674
MGI: 88332
Ensembl: ENSMUSG00000032093
Vega: OTTMUSG00000016712
UniProt: P22646 A6H6M1
Structure
PDB: 
2K4F

Position
9 A5.2; 9 24.84 cM
AA seq 189 aa
MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELP
QKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDI
CITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDL
YSGLNQRAV
NT seq 570 nt   +upstreamnt  +downstreamnt
atgcggtggaacactttctggggcatcctgtgcctcagcctcctagctgttggcacttgc
caggacgatgccgagaacattgaatacaaagtctccatctcaggaaccagtgtagagttg
acgtgccctctagacagtgacgagaacttaaaatgggaaaaaaatggccaagagctgcct
cagaagcatgataagcacctggtgctccaggatttctcggaagtcgaggacagtggctac
tacgtctgctacacaccagcctcaaataaaaacacgtacttgtacctgaaagctcgagtg
tgtgagtactgtgtggaggtggacctgacagcagtagccataatcatcattgttgacatc
tgtatcactctgggcttgctgatggtcatttattactggagcaagaataggaaggccaag
gccaagcctgtgacccgaggaaccggtgctggtagcaggcccagagggcaaaacaaggag
cggccaccacctgttcccaacccagactatgagcccatccgcaaaggccagcgggacctg
tattctggcctgaatcagagagcagtctga

KEGG   Mus musculus (mouse): 12502
Entry
12502             CDS       T01002                                 

Gene name
Cd3g, Ctg-3, Ctg3, T3g
Definition
(RefSeq) CD3 antigen, gamma polypeptide
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12502 (Cd3g)
   04660 T cell receptor signaling pathway
    12502 (Cd3g)
   04658 Th1 and Th2 cell differentiation
    12502 (Cd3g)
   04659 Th17 cell differentiation
    12502 (Cd3g)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12502 (Cd3g)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12502 (Cd3g)
   05170 Human immunodeficiency virus 1 infection
    12502 (Cd3g)
   05162 Measles
    12502 (Cd3g)
   05169 Epstein-Barr virus infection
    12502 (Cd3g)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12502 (Cd3g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12502 (Cd3g)
CD molecules [BR:mmu04090]
 Proteins
  12502 (Cd3g)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3
Other DBs
NCBI-GeneID: 12502
NCBI-ProteinID: NP_033980
MGI: 88333
Ensembl: ENSMUSG00000002033
Vega: OTTMUSG00000034601
UniProt: P11942 Q3U4Y3
Structure
PDB: 
1JBJ

Position
9 A5.2; 9 24.84 cM
AA seq 182 aa
MEQRKGLAGLFLVISLLQGTVAQTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGS
IISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTISGFIF
AEVISIFFLALGVYLIAGQDGVRQSRASDKQTLLQNEQLYQPLKDREYDQYSHLQGNQLR
KK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagcagaggaagggtctggctggcctcttcctggtgatctctcttcttcaaggcact
gtagcccagacaaataaagcaaagaatttggtacaagtggatggcagccgaggagacggt
tctgtacttctgacttgtggcttgactgacaagactatcaagtggcttaaagacgggagc
ataataagtcctctaaatgcaactaaaaacacatggaatctgggcaacaatgccaaagac
cctcgaggcacgtatcagtgtcaaggagcaaaggagacatcaaaccccctgcaagtgtat
tacagaatgtgtgaaaactgcattgagctaaacataggcaccatatccggctttatcttc
gctgaggtcatcagcatcttcttccttgctcttggtgtatatctcattgcgggacaggat
ggagttcgccagtcaagagcttcagacaagcagactctgttgcaaaatgaacagctgtac
cagcccctcaaggaccgggaatatgaccagtacagccatctccaaggaaaccaactgagg
aagaagtga

DBGET integrated database retrieval system