KEGG   Mus musculus (mouse): 12500
Entry
12500             CDS       T01002                                 

Gene name
Cd3d, T3d
Definition
(RefSeq) CD3 antigen, delta polypeptide
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12500 (Cd3d)
   04660 T cell receptor signaling pathway
    12500 (Cd3d)
   04658 Th1 and Th2 cell differentiation
    12500 (Cd3d)
   04659 Th17 cell differentiation
    12500 (Cd3d)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12500 (Cd3d)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12500 (Cd3d)
   05170 Human immunodeficiency virus 1 infection
    12500 (Cd3d)
   05162 Measles
    12500 (Cd3d)
   05169 Epstein-Barr virus infection
    12500 (Cd3d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12500 (Cd3d)
  09163 Immune disease
   05340 Primary immunodeficiency
    12500 (Cd3d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12500 (Cd3d)
CD molecules [BR:mmu04090]
 Proteins
  12500 (Cd3d)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5
Other DBs
NCBI-GeneID: 12500
NCBI-ProteinID: NP_038515
MGI: 88331
Ensembl: ENSMUSG00000032094
Vega: OTTMUSG00000063397
UniProt: P04235 Q3U4T1 Q3V3B4 Q6P5P1
Position
9 A5.2; 9 24.84 cM
AA seq 173 aa
MEHSGILASLILIAVLPQGSPFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNL
GKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLAL
GVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS
NT seq 522 nt   +upstreamnt  +downstreamnt
atggaacacagcgggattctggctagtctgatactgattgctgttctcccccaagggagc
cccttcaagatacaagtgaccgaatatgaggacaaagtatttgtgacctgcaataccagc
gtcatgcatctagatggaacggtggaaggatggtttgcaaagaataaaacactcaacttg
ggcaaaggcgttctggacccacgagggatatatctgtgtaatgggacagagcagctggca
aaggtggtgtcttctgtgcaagtccattaccgaatgtgccagaactgtgtggagctagac
tcgggcaccatggctggtgtcatcttcattgacctcatcgcaactctgctcctggctttg
ggcgtctactgctttgcaggacatgagaccggaaggccttctggggctgctgaggttcaa
gcactgctgaagaatgagcagctgtatcagcctcttcgagatcgtgaagatacccagtac
agccgtcttggagggaactggccccggaacaagaaatcttaa

KEGG   Mus musculus (mouse): 12501
Entry
12501             CDS       T01002                                 

Gene name
Cd3e, AI504783, CD3, CD3epsilon, T3e
Definition
(RefSeq) CD3 antigen, epsilon polypeptide
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12501 (Cd3e)
   04660 T cell receptor signaling pathway
    12501 (Cd3e)
   04658 Th1 and Th2 cell differentiation
    12501 (Cd3e)
   04659 Th17 cell differentiation
    12501 (Cd3e)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12501 (Cd3e)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12501 (Cd3e)
   05170 Human immunodeficiency virus 1 infection
    12501 (Cd3e)
   05162 Measles
    12501 (Cd3e)
   05169 Epstein-Barr virus infection
    12501 (Cd3e)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12501 (Cd3e)
  09163 Immune disease
   05340 Primary immunodeficiency
    12501 (Cd3e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12501 (Cd3e)
CD molecules [BR:mmu04090]
 Proteins
  12501 (Cd3e)
SSDB
Motif
Pfam: Ig_5 Ig_4 Ig_2 ITAM Ig_3 ig V-set I-set
Other DBs
NCBI-GeneID: 12501
NCBI-ProteinID: NP_031674
MGI: 88332
Ensembl: ENSMUSG00000032093
Vega: OTTMUSG00000016712
UniProt: P22646 A6H6M1
Structure
PDB: 
2K4F

Position
9 A5.2; 9 24.84 cM
AA seq 189 aa
MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELP
QKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDI
CITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDL
YSGLNQRAV
NT seq 570 nt   +upstreamnt  +downstreamnt
atgcggtggaacactttctggggcatcctgtgcctcagcctcctagctgttggcacttgc
caggacgatgccgagaacattgaatacaaagtctccatctcaggaaccagtgtagagttg
acgtgccctctagacagtgacgagaacttaaaatgggaaaaaaatggccaagagctgcct
cagaagcatgataagcacctggtgctccaggatttctcggaagtcgaggacagtggctac
tacgtctgctacacaccagcctcaaataaaaacacgtacttgtacctgaaagctcgagtg
tgtgagtactgtgtggaggtggacctgacagcagtagccataatcatcattgttgacatc
tgtatcactctgggcttgctgatggtcatttattactggagcaagaataggaaggccaag
gccaagcctgtgacccgaggaaccggtgctggtagcaggcccagagggcaaaacaaggag
cggccaccacctgttcccaacccagactatgagcccatccgcaaaggccagcgggacctg
tattctggcctgaatcagagagcagtctga

KEGG   Mus musculus (mouse): 12502
Entry
12502             CDS       T01002                                 

Gene name
Cd3g, Ctg-3, Ctg3, T3g
Definition
(RefSeq) CD3 antigen, gamma polypeptide
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12502 (Cd3g)
   04660 T cell receptor signaling pathway
    12502 (Cd3g)
   04658 Th1 and Th2 cell differentiation
    12502 (Cd3g)
   04659 Th17 cell differentiation
    12502 (Cd3g)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12502 (Cd3g)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12502 (Cd3g)
   05170 Human immunodeficiency virus 1 infection
    12502 (Cd3g)
   05162 Measles
    12502 (Cd3g)
   05169 Epstein-Barr virus infection
    12502 (Cd3g)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12502 (Cd3g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12502 (Cd3g)
CD molecules [BR:mmu04090]
 Proteins
  12502 (Cd3g)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3
Other DBs
NCBI-GeneID: 12502
NCBI-ProteinID: NP_033980
MGI: 88333
Ensembl: ENSMUSG00000002033
Vega: OTTMUSG00000034601
UniProt: P11942 Q3U4Y3
Structure
PDB: 
1JBJ

Position
9 A5.2; 9 24.84 cM
AA seq 182 aa
MEQRKGLAGLFLVISLLQGTVAQTNKAKNLVQVDGSRGDGSVLLTCGLTDKTIKWLKDGS
IISPLNATKNTWNLGNNAKDPRGTYQCQGAKETSNPLQVYYRMCENCIELNIGTISGFIF
AEVISIFFLALGVYLIAGQDGVRQSRASDKQTLLQNEQLYQPLKDREYDQYSHLQGNQLR
KK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagcagaggaagggtctggctggcctcttcctggtgatctctcttcttcaaggcact
gtagcccagacaaataaagcaaagaatttggtacaagtggatggcagccgaggagacggt
tctgtacttctgacttgtggcttgactgacaagactatcaagtggcttaaagacgggagc
ataataagtcctctaaatgcaactaaaaacacatggaatctgggcaacaatgccaaagac
cctcgaggcacgtatcagtgtcaaggagcaaaggagacatcaaaccccctgcaagtgtat
tacagaatgtgtgaaaactgcattgagctaaacataggcaccatatccggctttatcttc
gctgaggtcatcagcatcttcttccttgctcttggtgtatatctcattgcgggacaggat
ggagttcgccagtcaagagcttcagacaagcagactctgttgcaaaatgaacagctgtac
cagcccctcaaggaccgggaatatgaccagtacagccatctccaaggaaaccaactgagg
aagaagtga

KEGG   Mus musculus (mouse): 12503
Entry
12503             CDS       T01002                                 

Gene name
Cd247, 4930549J05Rik, A430104F18, A430104F18Rik, AW552088, CD3-et, CD3-zet, CD3zet, Cd3, Cd3-eta, Cd3-zeta, Cd3h, Cd3z, Cd3zeta, T3z, TCR, Tcrk, Tcrz
Definition
(RefSeq) CD247 antigen
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    12503 (Cd247)
   04660 T cell receptor signaling pathway
    12503 (Cd247)
   04658 Th1 and Th2 cell differentiation
    12503 (Cd247)
   04659 Th17 cell differentiation
    12503 (Cd247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12503 (Cd247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12503 (Cd247)
   05169 Epstein-Barr virus infection
    12503 (Cd247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12503 (Cd247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12503 (Cd247)
   04090 CD molecules [BR:mmu04090]
    12503 (Cd247)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12503 (Cd247)
CD molecules [BR:mmu04090]
 Proteins
  12503 (Cd247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta
Other DBs
NCBI-GeneID: 12503
NCBI-ProteinID: NP_001106862
MGI: 88334
Ensembl: ENSMUSG00000005763
Vega: OTTMUSG00000034863
UniProt: P24161 Q3UU54
Position
1 H2.3; 1 73.14 cM
AA seq 164 aa
MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDGILFIYGVIITALYLRAKFSRSAE
TAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMA
EAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaagtggaaagtgtctgttctcgcctgcatcctccacgtgcggttcccaggagcagag
gcacagagctttggtctgctggatcccaaactctgctacttgctagatggaatcctcttc
atctacggagtcatcatcacagccctgtacctgagagcaaaattcagcaggagtgcagag
actgctgccaacctgcaggaccccaaccagctctacaatgagctcaatctagggcgaaga
gaggaatatgacgtcttggagaagaagcgggctcgggatccagagatgggaggcaaacag
cagaggaggaggaacccccaggaaggcgtatacaatgcactgcagaaagacaagatggca
gaagcctacagtgagatcggcacaaaaggcgagaggcggagaggcaaggggcacgatggc
ctttaccagggtctcagcactgccaccaaggacacctatgatgccctgcatatgcagacc
ctggcccctcgctaa

DBGET integrated database retrieval system