KEGG   Mus musculus (mouse): 12501
Entry
12501             CDS       T01002                                 

Gene name
Cd3e, AI504783, CD3, CD3epsilon, T3e
Definition
(RefSeq) CD3 antigen, epsilon polypeptide
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12501 (Cd3e)
   04660 T cell receptor signaling pathway
    12501 (Cd3e)
   04658 Th1 and Th2 cell differentiation
    12501 (Cd3e)
   04659 Th17 cell differentiation
    12501 (Cd3e)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12501 (Cd3e)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12501 (Cd3e)
   05170 Human immunodeficiency virus 1 infection
    12501 (Cd3e)
   05162 Measles
    12501 (Cd3e)
   05169 Epstein-Barr virus infection
    12501 (Cd3e)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12501 (Cd3e)
  09163 Immune disease
   05340 Primary immunodeficiency
    12501 (Cd3e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12501 (Cd3e)
CD molecules [BR:mmu04090]
 Proteins
  12501 (Cd3e)
SSDB
Motif
Pfam: Ig_5 Ig_4 Ig_2 ITAM Ig_3 ig V-set I-set
Other DBs
NCBI-GeneID: 12501
NCBI-ProteinID: NP_031674
MGI: 88332
Ensembl: ENSMUSG00000032093
Vega: OTTMUSG00000016712
UniProt: P22646 A6H6M1
Structure
PDB: 
2K4F

Position
9 A5.2; 9 24.84 cM
AA seq 189 aa
MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELP
QKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDI
CITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDL
YSGLNQRAV
NT seq 570 nt   +upstreamnt  +downstreamnt
atgcggtggaacactttctggggcatcctgtgcctcagcctcctagctgttggcacttgc
caggacgatgccgagaacattgaatacaaagtctccatctcaggaaccagtgtagagttg
acgtgccctctagacagtgacgagaacttaaaatgggaaaaaaatggccaagagctgcct
cagaagcatgataagcacctggtgctccaggatttctcggaagtcgaggacagtggctac
tacgtctgctacacaccagcctcaaataaaaacacgtacttgtacctgaaagctcgagtg
tgtgagtactgtgtggaggtggacctgacagcagtagccataatcatcattgttgacatc
tgtatcactctgggcttgctgatggtcatttattactggagcaagaataggaaggccaag
gccaagcctgtgacccgaggaaccggtgctggtagcaggcccagagggcaaaacaaggag
cggccaccacctgttcccaacccagactatgagcccatccgcaaaggccagcgggacctg
tattctggcctgaatcagagagcagtctga

DBGET integrated database retrieval system