KEGG   Mus musculus (mouse): 12503
Entry
12503             CDS       T01002                                 

Gene name
Cd247, 4930549J05Rik, A430104F18, A430104F18Rik, AW552088, CD3-et, CD3-zet, CD3zet, Cd3, Cd3-eta, Cd3-zeta, Cd3h, Cd3z, Cd3zeta, T3z, TCR, Tcrk, Tcrz
Definition
(RefSeq) CD247 antigen
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05142  Chagas disease
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    12503 (Cd247)
   04660 T cell receptor signaling pathway
    12503 (Cd247)
   04658 Th1 and Th2 cell differentiation
    12503 (Cd247)
   04659 Th17 cell differentiation
    12503 (Cd247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12503 (Cd247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12503 (Cd247)
   05169 Epstein-Barr virus infection
    12503 (Cd247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12503 (Cd247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12503 (Cd247)
   04090 CD molecules [BR:mmu04090]
    12503 (Cd247)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12503 (Cd247)
CD molecules [BR:mmu04090]
 Proteins
  12503 (Cd247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta
Other DBs
NCBI-GeneID: 12503
NCBI-ProteinID: NP_001106862
MGI: 88334
Ensembl: ENSMUSG00000005763
Vega: OTTMUSG00000034863
UniProt: P24161 Q3UU54
Position
1 H2.3; 1 73.14 cM
AA seq 164 aa
MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDGILFIYGVIITALYLRAKFSRSAE
TAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMA
EAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaagtggaaagtgtctgttctcgcctgcatcctccacgtgcggttcccaggagcagag
gcacagagctttggtctgctggatcccaaactctgctacttgctagatggaatcctcttc
atctacggagtcatcatcacagccctgtacctgagagcaaaattcagcaggagtgcagag
actgctgccaacctgcaggaccccaaccagctctacaatgagctcaatctagggcgaaga
gaggaatatgacgtcttggagaagaagcgggctcgggatccagagatgggaggcaaacag
cagaggaggaggaacccccaggaaggcgtatacaatgcactgcagaaagacaagatggca
gaagcctacagtgagatcggcacaaaaggcgagaggcggagaggcaaggggcacgatggc
ctttaccagggtctcagcactgccaccaaggacacctatgatgccctgcatatgcagacc
ctggcccctcgctaa

DBGET integrated database retrieval system