KEGG   Mus musculus (mouse): 12504
Entry
12504             CDS       T01002                                 

Gene name
Cd4, L3T, L3T4, Ly-, Ly-4
Definition
(RefSeq) CD4 antigen
  KO
K06454  T-cell surface glycoprotein CD4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05135  Yersinia infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12504 (Cd4)
   04514 Cell adhesion molecules
    12504 (Cd4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12504 (Cd4)
   04612 Antigen processing and presentation
    12504 (Cd4)
   04660 T cell receptor signaling pathway
    12504 (Cd4)
   04658 Th1 and Th2 cell differentiation
    12504 (Cd4)
   04659 Th17 cell differentiation
    12504 (Cd4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12504 (Cd4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12504 (Cd4)
   05170 Human immunodeficiency virus 1 infection
    12504 (Cd4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    12504 (Cd4)
  09163 Immune disease
   05340 Primary immunodeficiency
    12504 (Cd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12504 (Cd4)
CD molecules [BR:mmu04090]
 Proteins
  12504 (Cd4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig V-set Ig_3 I-set Tcell_CD4_C Ig_2 Receptor_2B4
Other DBs
NCBI-GeneID: 12504
NCBI-ProteinID: NP_038516
MGI: 88335
Ensembl: ENSMUSG00000023274
Vega: OTTMUSG00000023420
UniProt: P06332 Q3TSV7
Position
6 F2; 6 59.17 cM
AA seq 457 aa
MCRAISLRRLLLLLLQLSQLLAVTQGKTLVLGKEGESAELPCESSQKKITVFTWKFSDQR
KILGQHGKGVLIRGGSPSQFDRFDSKKGAWEKGSFPLIINKLKMEDSQTYICELENRKEE
VELWVFKVTFSPGTSLLQGQSLTLTLDSNSKVSNPLTECKHKKGKVVSGSKVLSMSNLRV
QDSDFWNCTVTLDQKKNWFGMTLSVLGFQSTAITAYKSEGESAEFSFPLNFAEENGWGEL
MWKAEKDSFFQPWISFSIKNKEVSVQKSTKDLKLQLKETLPLTLKIPQVSLQFAGSGNLT
LTLDKGTLHQEVNLVVMKVAQLNNTLTCEVMGPTSPKMRLTLKQENQEARVSEEQKVVQV
VAPETGLWQCLLSEGDKVKMDSRIQVLSRGVNQTVFLACVLGGSFGFLGFLGLCILCCVR
CRHQQRQAARMSQIKRLLSEKKTCQCPHRMQKSHNLI
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgtgccgagccatctctcttaggcgcttgctgctgctgctgctgcagctgtcacaactc
ctagctgtcactcaagggaagacgctggtgctggggaaggaaggggaatcagcagaactg
ccctgcgagagttcccagaagaagatcacagtcttcacctggaagttctctgaccagagg
aagattctggggcagcatggcaaaggtgtattaattagaggaggttcgccttcgcagttt
gatcgttttgattccaaaaaaggggcatgggagaaaggatcgtttcctctcatcatcaat
aaacttaagatggaagactctcagacttatatctgtgagctggagaacaggaaagaggag
gtggagttgtgggtgttcaaagtgaccttcagtccgggtaccagcctgttgcaagggcag
agcctgaccctgaccttggatagcaactctaaggtctctaaccccttgacagagtgcaaa
cacaaaaagggtaaagttgtcagtggttccaaagttctctccatgtccaacctaagggtt
caggacagcgacttctggaactgcaccgtgaccctggaccagaaaaagaactggttcggc
atgacactctcagtgctgggttttcagagcacagctatcacggcctataagagtgaggga
gagtcagcggagttctccttcccactcaactttgcagaggaaaacgggtggggagagctg
atgtggaaggcagagaaggattctttcttccagccctggatctccttctccataaagaac
aaagaggtgtccgtacaaaagtccaccaaagacctcaagctccagctgaaggaaacgctc
ccactcaccctcaagataccccaggtctcgcttcagtttgctggttctggcaacctgact
ctgactctggacaaagggacactgcatcaggaagtgaacctggtggtgatgaaagtggct
cagctcaacaatactttgacctgtgaggtgatgggacctacctctcccaagatgagactg
accctgaagcaggagaaccaggaggccagggtctctgaggagcagaaagtagttcaagtg
gtggcccctgagacagggctgtggcagtgtctactgagtgaaggtgataaggtcaagatg
gactccaggatccaggttttatccagaggggtgaaccagacagtgttcctggcttgcgtg
ctgggtggctccttcggctttctgggtttccttgggctctgcatcctctgctgtgtcagg
tgccggcaccaacagcgccaggcagcacgaatgtctcagatcaagaggctcctcagtgag
aagaagacctgccagtgcccccaccggatgcagaagagccataatctcatctga

DBGET integrated database retrieval system