KEGG   Mus musculus (mouse): 12505Help
Entry
12505             CDS       T01002                                 

Gene name
Cd44, AU023126, AW121933, AW146109, HERMES, Ly-24, Pgp-1
Definition
(RefSeq) CD44 antigen
  KO
K06256  CD44 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu04640  Hematopoietic cell lineage
mmu05169  Epstein-Barr virus infection
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12505 (Cd44)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12505 (Cd44)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12505 (Cd44)
   05205 Proteoglycans in cancer
    12505 (Cd44)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    12505 (Cd44)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12505 (Cd44)
   04090 CD molecules [BR:mmu04090]
    12505 (Cd44)
   00535 Proteoglycans [BR:mmu00535]
    12505 (Cd44)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12505 (Cd44)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12505 (Cd44)
  Exosomal proteins of other body fluids (saliva and urine)
   12505 (Cd44)
  Exosomal proteins of colorectal cancer cells
   12505 (Cd44)
  Exosomal proteins of bladder cancer cells
   12505 (Cd44)
CD molecules [BR:mmu04090]
 Proteins
  12505 (Cd44)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Others
   12505 (Cd44)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Cell surface receptors
   12505 (Cd44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xlink
Motif
Other DBs
NCBI-GeneID: 12505
NCBI-ProteinID: NP_033981
MGI: 88338
Ensembl: ENSMUSG00000005087
Vega: OTTMUSG00000014837
UniProt: P15379 A2APM2
Structure
PDB: 

Position
2 E2; 2 54.13 cM
AA seq 780 aa AA seqDB search
MDKFWWHTAWGLCLLQLSLAHPHQQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAF
NSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYD
TYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIID
DDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLATIASTVHSKSHAAAQKQ
NNWIWSWFGNSQSTTQTQEPTTSATTALMTTPETPPKRQEAQNWFSWLFQPSESKSHLHT
TTKMPGTESNTNPTGWEPNEENEDETDKYPSFSGSGIDDDEDFISSTIASTPRVSARTED
NQDWTQWKPNHSNPEVLLQTTTRMADIDRISTSAHGENWTPEPQPPFNNHEYQDEEETPH
ATSTTPNSTAEAAATQQETWFQNGWQGKNPPTPSEDSHVTEGTTASAHNNHPSQRITTQS
QEDVSWTDFFDPISHPMGQGHQTESKDTDSSHSTTLQPTAAPNTHLVEDLNRTGPLSVTT
PQSHSQNFSTLHGEPEEDENHPTTSILPSSTKSGAKDARRGGSLPTDTTTSVEGYTFQYP
DTMENGTLFPVTPAKTEVFGETEVTLATDSNVNVDGSLPGDRDSSKDSRGSSRTVTHGSE
LAGHSSANQDSGVTTTSGPMRRPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKL
VINGGNGTVEDRKPSELNGEASKSQEMVHLVNKEPSETPDQCMTADETRNLQSVDMKIGV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggacaagttttggtggcacacagcttggggactttgcctcttgcagttgagcctggca
catccacatcagcagatcgatttgaatgtaacctgccgctacgcaggtgtattccatgtg
gagaaaaatggccgctacagtatctcccggactgaggcagctgacctctgccaggctttc
aacagtaccttacccaccatggaccaaatgaagttggccctgagcaagggttttgaaaca
tgcaggtatgggttcatagaaggaaatgtggtaattccgaggattcatcccaacgctatc
tgtgcagccaaccacacaggagtatatatcctcgtcacgtccaacacctcccactatgac
acatattgcttcaatgcctcagcccctcctgaagaagactgtacatcagtcacagaccta
cccaattccttcgatggaccggttaccataactattgtcaaccgtgatggtactcgctac
agcaagaagggcgagtatagaacacaccaagaagacatcgatgcttcaaacattatagat
gacgatgtcagcagcggctccaccatcgagaagagcaccccagaaagctacattttgcac
acctaccttcctactgaacagcctactggagatcaggatgactccttctttatccggagc
accttggccaccattgcctcaactgtgcactcaaaaagccatgcagcagctcagaaacaa
aataattggatatggtcttggtttggtaattcacagtccacaactcagactcaggagccc
acaacgagtgcaactacagccttgatgaccacccctgaaacaccacccaagaggcaagaa
gcccagaactggttttcatggttatttcaaccatcagagtccaagagtcatcttcataca
acaacgaagatgcctggtacggagtcaaataccaacccaacaggctgggagccaaatgag
gaaaatgaagatgaaacagacaaataccccagtttttctggatcaggcattgatgatgat
gaagattttatctccagtaccattgcaagtactccacgggtttctgcccgcacagaagac
aaccaggactggacccagtggaagccaaaccattcaaacccagaagtactactccagaca
accaccaggatggctgatatagacagaatcagcaccagtgctcatggagaaaattggacc
ccggaaccacagcctcctttcaataaccatgagtatcaggatgaagaggagaccccacat
gctacaagcacaactcctaatagtacagcagaagcagcagctacccagcaggagacgtgg
tttcagaacggatggcaggggaagaacccccctaccccaagtgaagactcccatgtgaca
gaagggacaactgcttcggcccacaacaaccatccaagtcaaagaataacaacacagagt
caagaggatgtttcctggacagatttcttcgacccaatctcacatccaatgggacaaggt
catcaaacagaaagcaaggatacagactccagtcatagtacaacccttcagcctactgca
gctccaaatacccatttggtggaagacttgaacaggacaggaccactttcagtgacaact
ccacagagtcattctcagaacttctctacattacatggagagccggaagaagacgaaaac
catccaacaacttctattctgccatctagcactaagagcggcgctaaagatgcaagaaga
ggtggaagtcttcccacagatacaactacttctgtagaaggctacacctttcaataccca
gacacaatggaaaatgggactctcttcccagtgacccctgctaaaactgaggtctttgga
gaaactgaagtgactcttgctactgactccaacgttaatgttgatggctccttaccagga
gatcgagactcatccaaggactccagggggagttcccgcactgtgactcatggatccgaa
ttagctggacactcaagtgcgaaccaggacagtggagtgaccacaacttctggtcctatg
aggagacctcagattccagaatggctcatcatcttggcatctctcctggcactggctctg
attcttgccgtctgcatcgcggtcaatagtaggagaaggtgtgggcagaagaaaaagctg
gtgatcaacggtggcaatgggacggtggaagacaggaaacccagtgagctcaacggggag
gccagcaagtctcaggaaatggtgcatttggtgaacaaggaaccatcagagaccccggac
cagtgtatgacagctgacgagacccggaatctgcagagtgtggacatgaagattggggtg
tag

DBGET integrated database retrieval system