KEGG   Mus musculus (mouse): 12506
Entry
12506             CDS       T01002                                 

Gene name
Cd48, AI449234, AW610730, BCM1, BLAS, BLAST, BLAST-1, BLAST1, Bcm-1, MEM-102, SLAMF2, Sgp-, Sgp-60
Definition
(RefSeq) CD48 antigen
  KO
K06479  CD48 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    12506 (Cd48)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12506 (Cd48)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    12506 (Cd48)
CD molecules [BR:mmu04090]
 Proteins
  12506 (Cd48)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  12506 (Cd48)
SSDB
Motif
Pfam: Ig_3 V-set Ig_2 ig I-set Adeno_E3_CR1
Other DBs
NCBI-GeneID: 12506
NCBI-ProteinID: NP_031675
MGI: 88339
Ensembl: ENSMUSG00000015355
Vega: OTTMUSG00000016904
UniProt: P18181
Structure
PDB: 
2PTT 2PTV

Position
1 H3; 1 79.54 cM
AA seq 240 aa
MCFIKQGWCLVLELLLLPLGTGFQGHSIPDINATTGSNVTLKIHKDPLGPYKRITWLHTK
NQKILEYNYNSTKTIFESEFKGRVYLEENNGALHISNVRKEDKGTYYMRVLRETENELKI
TLEVFDPVPKPSIEINKTEASTDSCHLRLSCEVKDQHVDYTWYESSGPFPKKSPGYVLDL
IVTPQNKSTFYTCQVSNPVSSKNDTVYFTLPCDLARSSGVCWTATWLVVTTLIIHRILLT
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtgcttcataaaacagggatggtgtctggtcctggaactgctactgctgcccttggga
actggatttcaaggtcattcaataccagatataaatgccaccaccggcagcaatgtaacc
ctgaaaatccataaggacccacttggaccatataaacgtatcacctggcttcatactaaa
aatcagaagattttagagtacaactataatagtacaaagacaatcttcgagtctgaattt
aaaggcagggtttatcttgaagaaaacaatggtgcacttcatatctctaatgtccggaaa
gaggacaaaggtacctactacatgagagtgctgcgtgaaactgagaacgagttgaagata
accctggaagtatttgatcctgtgcccaagccttccatagaaatcaataagactgaagcg
tcgactgattcctgtcacctgaggctatcgtgtgaggtaaaggaccagcatgttgactat
acttggtatgagagctcgggacctttccccaaaaagagtccaggatatgtgctcgatctc
atcgtcacaccacagaacaagtctacattttacacctgccaagtcagcaatcctgtaagc
agcaagaacgacacagtgtacttcactctaccttgtgatctagccagatcttctggagta
tgttggactgcaacttggctagtggtcacaacactcatcattcacaggatcctgttaacc
tga

DBGET integrated database retrieval system