KEGG   Mus musculus (mouse): 12511
Entry
12511             CDS       T01002                                 

Symbol
Cd6
Name
(RefSeq) CD6 antigen
  KO
K06456  T-cell surface glycoprotein CD6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12511 (Cd6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12511 (Cd6)
CD molecules [BR:mmu04090]
 Proteins
  12511 (Cd6)
SSDB
Motif
Pfam: SRCR SRCR_2 DAG1 DUF2207
Other DBs
NCBI-GeneID: 12511
NCBI-ProteinID: NP_033982
MGI: 103566
Ensembl: ENSMUSG00000024670
Vega: OTTMUSG00000036965
UniProt: Q61003
Position
19:complement(10766703..10807427)
AA seq 665 aa
MWLFLGIAGLLTAVLSGLPSPAPSGQHKNGTIPNMTLDLEERLGIRLVNGSSRCSGSVKV
LLESWEPVCAAHWNRAATEAVCKALNCGDSGKVTYLMPPTSELPPGATSGNTSSAGNTTW
ARAPTERCRGANWQFCKVQDQECSSDRRLVWVTCAENQAVRLVDGSSRCAGRVEMLEHGE
WGTVCDDTWDLQDAHVVCKQLKCGWAVKALAGLHFTPGQGPIHRDQVNCSGTEAYLWDCP
GRPGDQYCGHKEDAGVVCSEHQSWRLTGGIDSCEGQVEVYFRGVWSTVCDSEWYPSEAKV
LCRSLGCGSAVARPRGLPHSLDGRMYYSCKGQEPALSTCSWRFNNSNLCSQSRAARVVCS
GSQRHLNLSTSEVPSRVPVTIESSVPVSVKDKDSQGLTLLILCIVLGILLLVSTIFIVIL
LLRAKGQYALPASVNHQQLSTANQAGINNYHPVPITIAKEAPMLFIQPRVPADSDSSSDS
DYEHYDFSSQPPVALTTFYNSQRHRVTEEEAQQNRFQMPPLEEGLEELHVSHIPAADPRP
CVADVPSRGSQYHVRNNSDSSTSSEEGYCNDPSSKPPPWNSQAFYSEKSPLTEQPPNLEL
AGSPAVFSGPSADDSSSTSSGEWYQNFQPPPQHPPAEQFECPGPPGPQTDSIDDDEEDYD
DIGAA
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgtggctcttccttgggatcgctggattgctgacagcagttctctcaggtctcccatct
ccagccccctctggccagcacaaaaatggcaccatcccgaacatgaccttggacctagag
gagcggctggggattcgcctggtgaacgggagcagtcgctgcagcggatctgtgaaggtt
ctactggagtcctgggagcctgtgtgtgcggcacactggaacagggctgctacggaggct
gtgtgcaaagcgctgaactgtggtgattcgggaaaggttacctacctgatgccacccacc
tctgagcttccaccaggagccacttctgggaacacaagcagcgccgggaatacgacgtgg
gcgcgggcaccaactgagagatgcaggggagccaattggcagttctgcaaggtgcaggac
caggagtgtagcagcgacaggcggctggtgtgggtcacctgtgcagagaaccaagcagtg
cggttagtggatggtagcagccgctgtgctggccgagtggagatgctggagcatggtgaa
tggggtaccgtgtgcgacgacacgtgggacctgcaggatgcacacgtagtgtgtaagcaa
ctgaagtgcggctgggcagtgaaggcgctggccggcttgcacttcaccccaggccaagga
cccatccaccgcgatcaggtgaactgctctgggactgaggcttacctgtgggactgcccg
ggacggccaggagaccagtactgtggtcacaaggaggacgcaggagtggtgtgctcagag
caccagtcctggcgcctgactggaggcattgactcctgcgaagggcaagtggaagtgtac
ttccggggtgtctggagcacggtgtgtgacagcgagtggtacccatctgaggccaaagtg
ctctgtcggtccttgggttgcggatcagcagtggctcggcccagggggctgccacactcc
ctggacggtagaatgtactactcctgcaaaggacaggagcccgccctcagcacctgttcc
tggcggttcaacaactccaacctgtgcagccagtcgcgggcagccagggttgtctgctca
ggctcccagagacatctcaatctgtctacttctgaagtgccttccagagttccagtcacg
atagaatcttctgtgccggtgagcgtgaaggataaggactcacaagggctgacacttctc
attctctgtattgtcctgggaattctcctcctcgtctccaccatcttcatagttattctt
ctcttgagagccaaaggacaatacgccctccctgcttcagtgaaccaccagcaactgtct
actgccaaccaagcagggatcaataactaccatcctgtccctatcaccattgccaaagaa
gctcctatgctgttcatccagccccgggtccctgcagactcggactccagttctgactcc
gactatgagcactatgacttcagctcccagccacctgtggccctgaccaccttctacaat
tcccagcgacaccgggtcacagaggaggaagctcagcagaacaggtttcagatgccaccc
ttggaggaaggacttgaagagctgcatgtttcccacatcccagcggctgaccccagaccc
tgtgtggcagatgtcccctctcggggctctcagtaccacgtgaggaacaacagtgattcc
agcacctcctctgaggagggctactgcaatgatcccagcagcaagccacctccatggaat
tcccaggcgttttattctgagaagagtcccctcacagagcagccccccaacttggaactg
gctggctctccggcagtgttttcagggccctcagccgatgacagctccagcacctcatcc
ggagagtggtaccagaacttccagccaccaccccagcatcctccagcagaacagtttgaa
tgtccaggaccccctggcccccaaacagactccattgatgatgatgaggaggattacgat
gacatcggtgcagcctag

DBGET integrated database retrieval system