KEGG   Mus musculus (mouse): 12512Help
Entry
12512             CDS       T01002                                 

Gene name
Cd63, C75951, ME491, Tspan30
Definition
(RefSeq) CD63 antigen
  KO
K06497  CD63 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    12512 (Cd63)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    12512 (Cd63)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12512 (Cd63)
   04090 CD molecules [BR:mmu04090]
    12512 (Cd63)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   12512 (Cd63)
CD molecules [BR:mmu04090]
 Proteins
  12512 (Cd63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin TssN DUF2070 DUF2371
Motif
Other DBs
NCBI-GeneID: 12512
NCBI-ProteinID: NP_001036045
MGI: 99529
Ensembl: ENSMUSG00000025351
UniProt: P41731 Q549D0
Position
10 D3; 10 77.19 cM
AA seq 238 aa AA seqDB search
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAV
GAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQ
QQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGND
FKESTIHTQGCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSIRSGYEVM
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggaaggaggaatgaagtgtgtcaagtttttgctctacgttctcctgctggcc
ttctgcgcctgtgcagtgggattgatcgccattggtgtagcggttcaggttgtcttgaag
caggccattacccatgagactactgctggctcgctgttgcctgtggtcatcattgcagtg
ggtgccttcctcttcctggtggcctttgtgggctgctgtggggcctgcaaggagaactac
tgtctcatgattacatttgccatcttcctgtctcttatcatgcttgtggaggtggctgtg
gccattgctggctatgtgtttagagaccaggtgaagtcagagtttaataaaagcttccag
cagcagatgcagaattaccttaaagacaacaaaacagccactattttggacaaattgcag
aaagaaaataactgctgtggagcttctaactacacagactgggaaaacatccccggcatg
gccaaggacagagtccccgattcttgctgcatcaacataactgtgggctgtgggaatgat
ttcaaggaatccactatccatacccagggctgcgtggagactatagcaatatggctaagg
aagaacatactgctggtggctgcagcggccctgggcattgcttttgtggaggtcttggga
attatcttctcctgctgtctggtgaagagtattcgaagtggctatgaagtaatgtag

DBGET integrated database retrieval system