KEGG   Mus musculus (mouse): 12520
Entry
12520             CDS       T01002                                 

Gene name
Cd81, Ta, Tap, Tapa-1, Tapa1, Tsp, Tspan28
Definition
(RefSeq) CD81 antigen
  KO
K06508  CD81 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04662  B cell receptor signaling pathway
mmu05144  Malaria
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    12520 (Cd81)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    12520 (Cd81)
  09174 Infectious disease: parasitic
   05144 Malaria
    12520 (Cd81)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12520 (Cd81)
   04090 CD molecules [BR:mmu04090]
    12520 (Cd81)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   12520 (Cd81)
CD molecules [BR:mmu04090]
 Proteins
  12520 (Cd81)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 12520
NCBI-ProteinID: NP_598416
MGI: 1096398
Ensembl: ENSMUSG00000037706
Vega: OTTMUSG00000031887
UniProt: P35762
Structure
PDB: 
3X0F

Position
7 F5; 7 88.1 cM
AA seq 236 aa
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTSLLYLELGNKPAPNTFYV
GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA
KDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGN
ILTPLLQQDCHQKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
NT seq 711 nt   +upstreamnt  +downstreamnt
atgggggtggagggctgcaccaaatgcatcaaatacctgctcttcgtcttcaatttcgtc
ttctggctggctggaggcgtgatcctaggtgtagctctgtggttgcgtcatgatccacag
accaccagcctgctgtacctggaactgggaaacaaaccggcacccaacaccttctacgtg
ggcatctacattctcattgctgtgggagctgtgatgatgtttgtaggcttcctggggtgc
tatggggccatccaggagtcccagtgtctgctggggacgttcttcacctgccttgtgatc
ctgtttgcctgtgaggtggctgcaggcatctggggcttcgtaaacaaagaccagatcgcc
aaggatgtgaagcagttctatgaccaggcccttcagcaagctgtgatggatgatgatgcc
aacaatgccaaggctgtggtgaagactttccatgagacgctcaactgttgtggctccaac
gcactgaccacactgactaccaccatactgaggaacagcctgtgtccctcaggcggcaac
atactcacccccttactgcagcaagattgtcatcagaaaatcgatgagctcttctctggg
aagctgtacctcattggaattgcagccattgtggtagctgtcattatgatctttgagatg
attctgagcatggtgctgtgctgtggcatccggaacagctccgtgtactga

DBGET integrated database retrieval system