KEGG   Mus musculus (mouse): 12525Help
Entry
12525             CDS       T01002                                 

Gene name
Cd8a, BB154331, Ly-2, Ly-35, Ly-B, Lyt-2
Definition
(RefSeq) CD8 antigen, alpha chain
  KO
K06458  T-cell surface glycoprotein CD8 alpha chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04660  T cell receptor signaling pathway
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    12525 (Cd8a)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12525 (Cd8a)
   04612 Antigen processing and presentation
    12525 (Cd8a)
   04660 T cell receptor signaling pathway
    12525 (Cd8a)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    12525 (Cd8a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12525 (Cd8a)
CD molecules [BR:mmu04090]
 Proteins
  12525 (Cd8a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_5 Ig_4 Ig_2 GTP_cyclohydro2
Motif
Other DBs
NCBI-GeneID: 12525
NCBI-ProteinID: NP_001074579
MGI: 88346
Ensembl: ENSMUSG00000053977
Vega: OTTMUSG00000057913
UniProt: P01731
Structure
PDB: 

Position
6 C1; 6 32.14 cM
AA seq 247 aa AA seqDB search
MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVS
QGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFS
KENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRP
RGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKP
RPSEKIV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaccgttgacccgctttctgtcgctgaacctgctgctgctgggtgagtcgatt
atcctggggagtggagaagctaagccacaggcacccgaactccgaatctttccaaagaaa
atggacgccgaacttggtcagaaggtggacctggtatgtgaagtgttggggtccgtttcg
caaggatgctcttggctcttccagaactccagctccaaactcccccagcccaccttcgtt
gtctatatggcttcatcccacaacaagataacgtgggacgagaagctgaattcgtcgaaa
ctgttttctgccatgagggacacgaataataagtacgttctcaccctgaacaagttcagc
aaggaaaacgaaggctactatttctgctcagtcatcagcaactcggtgatgtacttcagt
tctgtcgtgccagtccttcagaaagtgaactctactactaccaagccagtgctgcgaact
ccctcacctgtgcaccctaccgggacatctcagccccagagaccagaagattgtcggccc
cgtggctcagtgaaggggaccggattggacttcgcctgtgatatttacatctgggcaccc
ttggccggaatctgcgtggcccttctgctgtccttgatcatcactctcatctgctaccac
aggagccgaaagcgtgtttgcaaatgtcccaggccgctagtcagacaggaaggcaagccc
agaccttcagagaaaattgtgtaa

DBGET integrated database retrieval system