KEGG   Mus musculus (mouse): 12526
Entry
12526             CDS       T01002                                 

Gene name
Cd8b1, Cd8b, Ly-, Ly-3, Ly-C, Lyt-, Lyt-3
Definition
(RefSeq) CD8 antigen, beta chain 1
  KO
K06459  T-cell surface glycoprotein CD8 beta chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04660  T cell receptor signaling pathway
mmu05135  Yersinia infection
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12526 (Cd8b1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12526 (Cd8b1)
   04612 Antigen processing and presentation
    12526 (Cd8b1)
   04660 T cell receptor signaling pathway
    12526 (Cd8b1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    12526 (Cd8b1)
  09163 Immune disease
   05340 Primary immunodeficiency
    12526 (Cd8b1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12526 (Cd8b1)
CD molecules [BR:mmu04090]
 Proteins
  12526 (Cd8b1)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set CD34_antigen Orf78
Other DBs
NCBI-GeneID: 12526
NCBI-ProteinID: NP_033988
MGI: 88347
Ensembl: ENSMUSG00000053044
Vega: OTTMUSG00000057911
UniProt: P10300 Q3TEK8
Structure
PDB: 
2ATP 3DMM 3B9K

Position
6 C1; 6 32.14 cM
AA seq 213 aa
MQPWLWLVFSMKLAALWSSSALIQTPSSLLVQTNHTAKMSCEVKSISKLTSIYWLRERQD
PKDKYFEFLASWSSSKGVLYGESVDKKRNIILESSDSRRPFLSIMNVKPEDSDFYFCATV
GSPKMVFGTGTKLTVVDVLPTTAPTKKTTLKMKKKKQCPFPHPETQKGLTCSLTTLSLLV
VCILLLLAFLGVAVYFYCVRRRARIHFMKQFHK
NT seq 642 nt   +upstreamnt  +downstreamnt
atgcagccatggctctggctggtcttcagtatgaagctggcagctctctggagcagctct
gccctcattcagaccccttcgtccctgctggttcaaaccaaccatacggcaaagatgtcc
tgtgaggttaaaagcatctctaagttaacaagcatctactggctgcgggagcgccaggac
cccaaggacaagtactttgagttcctggcctcctggagttcttccaaaggagttttgtat
ggtgaaagtgtggacaagaaaagaaatataattcttgagtcttcagactcaagacggccc
tttctcagtatcatgaatgtgaagccagaggacagtgacttctacttctgcgcgacggtt
gggagccccaagatggtctttgggacagggacgaagctgactgtggttgatgtccttcct
acaactgccccaaccaagaagactaccctgaagatgaagaagaagaagcaatgcccgttc
ccccacccagagacccagaagggcctgacatgcagccttaccaccctcagcctgctggta
gtctgcatcctgcttctgctggcattcctcggagtggccgtctacttttactgtgtgcgg
aggagagcccgaattcacttcatgaaacagtttcacaaatga

DBGET integrated database retrieval system