KEGG   Mus musculus (house mouse): 12527
Entry
12527             CDS       T01002                                 
Symbol
Cd9, Tspan29
Name
(RefSeq) CD9 antigen
  KO
K06460  CD9 antigen
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12527 (Cd9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    12527 (Cd9)
   04147 Exosome [BR:mmu04147]
    12527 (Cd9)
   04090 CD molecules [BR:mmu04090]
    12527 (Cd9)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   12527 (Cd9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   12527 (Cd9)
CD molecules [BR:mmu04090]
 Proteins
  12527 (Cd9)
SSDB
Motif
Pfam: Tetraspanin CD20 IBV_3C DUF5321
Other DBs
NCBI-GeneID: 12527
NCBI-ProteinID: NP_031683
MGI: 88348
Ensembl: ENSMUSG00000030342
UniProt: P40240
Position
6:complement(125437229..125471723)
AA seq 226 aa
MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYI
LIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQ
EFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCP
EAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
NT seq 681 nt   +upstreamnt  +downstreamnt
atgccggtcaaaggaggtagcaagtgcatcaaatacctgctcttcggatttaacttcatc
ttctggctcgctggcattgcagtgcttgctattggactatggctccgattcgactctcag
accaagagcatcttcgagcaagagaataaccattccagtttctacacaggagtgtacatt
ctgattggagccggggccctcatgatgctggttggtttcctgggctgctgtggagctgta
caagagtcccagtgcatgctgggattgttcttcgggttcctcttggtgatattcgccatt
gagatagccgccgccgtctggggctatacccacaaggatgaggtgattaaagaactccag
gagttttacaaggacacctaccaaaagttacggagcaaggatgaaccccagcgggaaaca
ctcaaagccatccatatggcgttggactgctgtggcatagctggtcctttggagcagttt
atctcggacacctgccccaagaaacagcttttggaaagtttccaggttaagccctgccct
gaagccatcagtgaggtcttcaacaacaagttccacatcattggagcagtgggtatcggc
atcgccgtggtgatgatcttcggcatgatcttcagcatgatcctgtgctgcgccatccgc
aggagccgagaaatggtctag

DBGET integrated database retrieval system