KEGG   Mus musculus (mouse): 12530Help
Entry
12530             CDS       T01002                                 

Gene name
Cdc25a, D9Ertd393e
Definition
(RefSeq) cell division cycle 25A
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04218  Cellular senescence
mmu04914  Progesterone-mediated oocyte maturation
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12530 (Cdc25a)
   04218 Cellular senescence
    12530 (Cdc25a)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12530 (Cdc25a)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12530 (Cdc25a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    12530 (Cdc25a)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12530 (Cdc25a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     12530 (Cdc25a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    12530 (Cdc25a)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    12530 (Cdc25a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: M-inducer_phosp Rhodanese
Motif
Other DBs
NCBI-GeneID: 12530
NCBI-ProteinID: NP_031684
MGI: 103198
Ensembl: ENSMUSG00000032477
Vega: OTTMUSG00000051511
UniProt: P48964
Position
9 F2; 9 59.81 cM
AA seq 514 aa AA seqDB search
MELGPEPPHRRRLFFACSPTPAPQPTGKMLFGASAAGGLSPVTNLTVTMDQLEGLGSDCE
KMEVRNNSSLQRMGSSESTDSGFCLDSPGPLDSKENLEISLTRINSLPQKLLGCSPALKR
SHSDSLDHDTFHLIDQDENKENEAFEFKKPIRPASRHIYEESKDPFTHRQNSAPARMLSS
NESESGNFSPLFIPQSPVKATLSDEDDGFIDLLDGENMKNDEETPSCMASLWTAPLVMRR
PANLADRCGLFDSPSPCGSSTRAVLKRADRSHEEPPRGTKRRKSVPSPVKAKADVPEPAQ
LPSQSLSLMSSPKGTIENILDSDPRDLIGDFSKGYLFNTVSGKHQDLKYISPEIMASVLN
GKFAGLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKNPIVPTDGKRVIVVFH
CEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFLKCQSHCEPPSYRPMH
HEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggaactgggcccggagcccccccaccgccgccgcctgttcttcgcttgcagccccacg
cctgcgccgcagcccacggggaagatgctgtttggcgcgtcagctgctggcggactgtcc
cctgtcaccaacctgacggtcaccatggaccagctggaaggactgggcagtgactgtgag
aaaatggaagtgagaaataacagcagtctacagagaatgggctcctcagaatcgaccgat
tcaggtttctgtctagattctcctgggcccttggacagtaaagaaaaccttgaaatttcc
ctgacgagaataaattccctacctcagaagctcctgggatgtagcccagccctgaagagg
agccactctgattctctagaccacgacacctttcacctcatcgaccaggatgaaaataaa
gaaaatgaagcatttgaatttaaaaagccaatacgacctgcatctcgtcacatctacgag
gagagtaaagatccctttacacacaggcagaattcagccccagctcggatgctatcttca
aatgaaagtgaatcaggaaatttcagtcctctttttataccccagtcacctgtaaaagcc
actttgtccgatgaggatgatggcttcatagaccttctggatggcgagaatatgaagaat
gatgaggagaccccatcatgcatggcaagcctctggacagctccccttgtcatgaggaga
cctgcaaaccttgccgatcgttgcgggctgtttgactccccttccccgtgcggctccagc
actcgggcggtgttgaagagagcagaccggtctcacgaggagcctcctcggggtacaaag
aggaggaagagtgtgcccagccctgtgaaggcgaaggcggatgttccggagcccgcccag
cttccatcccagtctctatccctgatgtcttcccccaaaggaaccattgagaacattttg
gacagtgacccaagagaccttataggagatttctccaagggttatctctttaatacagtc
tctgggaagcatcaggatttgaaatatatttctccagaaattatggcatctgttttgaat
ggcaagtttgccggtctcattaaagagtttgttatcattgactgccgatacccatatgag
tatgaaggaggtcacatcaagggtgccgtgaatctgcacatggaagaagaggttgaagac
ttcttacttaagaaccctattgtgcctactgatggcaagcgtgtcattgtcgtgttccac
tgtgagttttcctctgaaagaggccctcgaatgtgccgatatgtgagagagagagatagg
ctcggcaatgagtaccccaagctccactaccctgagctgtatgtcctgaaggggggatac
aaggagttctttttgaagtgccagtctcactgtgaaccccccagctaccggccaatgcac
catgaagactttaaagaagacctaaagaagttccgcaccaagagccggacctgggcagga
gaaaagagcaaaagagagatgtacagtcgcctgaagaagctctga

DBGET integrated database retrieval system