KEGG   Mus musculus (mouse): 12530
Entry
12530             CDS       T01002                                 

Gene name
Cdc25a, D9Ertd393, D9Ertd393e
Definition
(RefSeq) cell division cycle 25A
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04218  Cellular senescence
mmu04914  Progesterone-mediated oocyte maturation
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12530 (Cdc25a)
   04218 Cellular senescence
    12530 (Cdc25a)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12530 (Cdc25a)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12530 (Cdc25a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    12530 (Cdc25a)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12530 (Cdc25a)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12530 (Cdc25a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     12530 (Cdc25a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    12530 (Cdc25a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     12530 (Cdc25a)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    12530 (Cdc25a)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 12530
NCBI-ProteinID: NP_031684
MGI: 103198
Ensembl: ENSMUSG00000032477
Vega: OTTMUSG00000051511
UniProt: P48964
Position
9 F2; 9 59.81 cM
AA seq 514 aa
MELGPEPPHRRRLFFACSPTPAPQPTGKMLFGASAAGGLSPVTNLTVTMDQLEGLGSDCE
KMEVRNNSSLQRMGSSESTDSGFCLDSPGPLDSKENLEISLTRINSLPQKLLGCSPALKR
SHSDSLDHDTFHLIDQDENKENEAFEFKKPIRPASRHIYEESKDPFTHRQNSAPARMLSS
NESESGNFSPLFIPQSPVKATLSDEDDGFIDLLDGENMKNDEETPSCMASLWTAPLVMRR
PANLADRCGLFDSPSPCGSSTRAVLKRADRSHEEPPRGTKRRKSVPSPVKAKADVPEPAQ
LPSQSLSLMSSPKGTIENILDSDPRDLIGDFSKGYLFNTVSGKHQDLKYISPEIMASVLN
GKFAGLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKNPIVPTDGKRVIVVFH
CEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFLKCQSHCEPPSYRPMH
HEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggaactgggcccggagcccccccaccgccgccgcctgttcttcgcttgcagccccacg
cctgcgccgcagcccacggggaagatgctgtttggcgcgtcagctgctggcggactgtcc
cctgtcaccaacctgacggtcaccatggaccagctggaaggactgggcagtgactgtgag
aaaatggaagtgagaaataacagcagtctacagagaatgggctcctcagaatcgaccgat
tcaggtttctgtctagattctcctgggcccttggacagtaaagaaaaccttgaaatttcc
ctgacgagaataaattccctacctcagaagctcctgggatgtagcccagccctgaagagg
agccactctgattctctagaccacgacacctttcacctcatcgaccaggatgaaaataaa
gaaaatgaagcatttgaatttaaaaagccaatacgacctgcatctcgtcacatctacgag
gagagtaaagatccctttacacacaggcagaattcagccccagctcggatgctatcttca
aatgaaagtgaatcaggaaatttcagtcctctttttataccccagtcacctgtaaaagcc
actttgtccgatgaggatgatggcttcatagaccttctggatggcgagaatatgaagaat
gatgaggagaccccatcatgcatggcaagcctctggacagctccccttgtcatgaggaga
cctgcaaaccttgccgatcgttgcgggctgtttgactccccttccccgtgcggctccagc
actcgggcggtgttgaagagagcagaccggtctcacgaggagcctcctcggggtacaaag
aggaggaagagtgtgcccagccctgtgaaggcgaaggcggatgttccggagcccgcccag
cttccatcccagtctctatccctgatgtcttcccccaaaggaaccattgagaacattttg
gacagtgacccaagagaccttataggagatttctccaagggttatctctttaatacagtc
tctgggaagcatcaggatttgaaatatatttctccagaaattatggcatctgttttgaat
ggcaagtttgccggtctcattaaagagtttgttatcattgactgccgatacccatatgag
tatgaaggaggtcacatcaagggtgccgtgaatctgcacatggaagaagaggttgaagac
ttcttacttaagaaccctattgtgcctactgatggcaagcgtgtcattgtcgtgttccac
tgtgagttttcctctgaaagaggccctcgaatgtgccgatatgtgagagagagagatagg
ctcggcaatgagtaccccaagctccactaccctgagctgtatgtcctgaaggggggatac
aaggagttctttttgaagtgccagtctcactgtgaaccccccagctaccggccaatgcac
catgaagactttaaagaagacctaaagaagttccgcaccaagagccggacctgggcagga
gaaaagagcaaaagagagatgtacagtcgcctgaagaagctctga

KEGG   Mus musculus (mouse): 12531
Entry
12531             CDS       T01002                                 

Gene name
Cdc25b, AI604853
Definition
(RefSeq) cell division cycle 25B
  KO
K05866  M-phase inducer phosphatase 2 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04110  Cell cycle
mmu04914  Progesterone-mediated oocyte maturation
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12531 (Cdc25b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12531 (Cdc25b)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12531 (Cdc25b)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12531 (Cdc25b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    12531 (Cdc25b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12531 (Cdc25b)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12531 (Cdc25b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     12531 (Cdc25b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    12531 (Cdc25b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     12531 (Cdc25b)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    12531 (Cdc25b)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 12531
NCBI-ProteinID: NP_075606
MGI: 99701
Ensembl: ENSMUSG00000027330
Vega: OTTMUSG00000016040
UniProt: P30306 Q9DBN8 Q3U535
Position
2 F1; 2 63.29 cM
AA seq 576 aa
MEVPLQKSAPGSALSPARVLGGIQRPRHLSVFEFESDGFLGSPEPTASSSPVTTLTQTMH
NLAGLGSEPPKAQVGSLSFQNRLADLSLSRRTSECSLSSESSESSDAGLCMDSPSPVDPQ
MAERTFEQAIQAASRVIQNEQFTIKRFRSLPVRLLEHSPVLQSITNSRALDSWRKTEAGY
RAAANSPGEDKENDGYIFKMPQELPHSSSAQALAEWVSRRQAFTQRPSSAPDLMCLTTEW
KMEVEELSPVAQSSSLTPVERASEEDDGFVDILESDLKDDEKVPAGMENLISAPLVKKLD
KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRKSVTPLEEQQL
EEPKARVFRSKSLCHEIENILDSDHRGLIGDYSKAFLLQTVDGKHQDLKYISPETMVALL
TGKFSNIVEKFVIVDCRYPYEYEGGHIKNAVNLPLERDAETFLLQRPIMPCSLDKRIILI
FHCEFSSERGPRMCRFIRERDRAANDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRP
MNHEAFRDELRNFRLKTRSWAGERSRRELCSRLQDQ
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggaggtacccctgcagaagtctgcgccgggttcagctctcagtcctgcccgcgtgctg
ggtggcattcagcggccgcgccacctctcggtctttgagtttgagtctgatggcttcctg
gggtctccggagcctacagcttcctcctctccggttaccactcttacacagaccatgcac
aacctcgctgggctcggcagtgagcctccaaaagctcaagtaggaagcctgtcgttccag
aacaggctggcagacctatccctgtccaggcgcacctctgagtgctccctgtcatctgag
tcctcagaatcttcggatgcaggtctgtgcatggactcccccagccctgtggacccgcag
atggcagagcgcacgtttgaacaggccattcaggcagccagtcgggtcattcaaaatgag
cagtttaccataaaacgcttccgatccttaccagtgaggctgctggaacacagtccggtg
ctgcagagcatcaccaactcccgagcactggacagctggaggaaaactgaagcaggctac
cgagccgccgccaatagtcctggggaggacaaagagaatgatggatatatcttcaagatg
ccacaggagctccctcattccagctctgcccaagctttggcagaatgggtcagccgcaga
caggcctttacccagaggcccagctcagcccctgacttgatgtgtcttaccactgagtgg
aagatggaagtagaggagctgagcccggtggcacagtcttcttccttgactcctgtcgaa
agggcttctgaagaagatgacggatttgtggacatcctggagagtgatttaaaggatgac
gagaaggtccccgcgggcatggagaacctcattagtgccccactggtcaaaaagctggat
aaggaagaggaacaggatctcatcatgttcagcaagtgccagaggctcttccgctcccca
tccatgccatgcagtgtgatccgacccatcctcaagaggctagagcggccccaggaccgg
gatgtgcctgtccagagcaagcgcaggaaaagtgtgacacccctggaagagcagcagctt
gaagaacctaaggcccgtgtctttcgctcaaagtcgctgtgtcatgagattgagaacatc
ctggatagtgaccaccgtggactgatcggagattactctaaggccttcctcctgcagacc
gtggatggcaaacaccaagaccttaagtacatctcaccagaaactatggtggccctgtta
acaggcaagttcagcaacatcgtggagaaatttgtcattgtggactgcagatacccctat
gagtatgaaggcgggcatatcaagaatgctgtgaacctgcccctggaacgggatgctgag
acctttctgctgcagcgtcccatcatgccttgtagcctggacaagagaatcatcctcatt
ttccactgtgaattctcgtctgagcgtggaccacgaatgtgccgcttcatcagggaacgg
gaccgtgcagctaacgactaccccagcctgtactacccggagatgtacatcctcaaaggc
ggctacaaggagttcttcccacagcatccgaacttttgtgagccccaggactaccgaccc
atgaaccacgaggctttcagggatgagctgaggaactttcgccttaagactcgcagctgg
gctggggaacggagcaggagggaactttgtagcaggctgcaagaccagtga

KEGG   Mus musculus (mouse): 12532
Entry
12532             CDS       T01002                                 

Gene name
Cdc25c, Cdc25
Definition
(RefSeq) cell division cycle 25C
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
mmu05170  Human immunodeficiency virus 1 infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12532 (Cdc25c)
   04114 Oocyte meiosis
    12532 (Cdc25c)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12532 (Cdc25c)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12532 (Cdc25c)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12532 (Cdc25c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    12532 (Cdc25c)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12532 (Cdc25c)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12532 (Cdc25c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     12532 (Cdc25c)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12532 (Cdc25c)
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    12532 (Cdc25c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     12532 (Cdc25c)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    12532 (Cdc25c)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 12532
NCBI-ProteinID: NP_033990
MGI: 88350
Ensembl: ENSMUSG00000044201
UniProt: P48967 Q3UR74
Position
18 B1; 18 18.71 cM
AA seq 447 aa
MSTGPIPPASEEGSFVSAPSFRSKQRKILHLLLERNTSFTIRSDFPESPKDKLHDSANLS
ILSGGTPKCCLDLSNLSSGEMSASPLTTSADLEDNGSLDSSGPLDRQLTGKDFHQDLMKG
IPVQLLCSTPNAMNHGHRKKIAKRSTSAHKENINTSLKALEWEAPRTPRFRKMPGGPLTS
PLCELEMKHLGSPITTVPKLSQNVKLEDQERISEDPMECSLGDQDAKGLSLRKMVPLCDM
NAIQMEEEESGSELLIGDFSKVCVLPTVPGKHPDLKYISPDTVAALLSGKFQSVIERFYI
IDCRYPYEYLGGHILGALNLHSQKELHEFFLRKPVVPLDIQKRVIIVFLCEFSSERGPRM
CRSLREKDRALNQYPALYYPELYILKGGYRDFFPEYMELCDPQSYCPMLHQDHQAELLSW
RSQSKAQEGERQLQGQIALLVKGASPQ
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtctacaggacctatcccacctgcaagtgaagagggaagttttgtttcagcacccagt
tttaggtccaaacaaaggaagatattacacctacttttggagagaaacacttcttttacc
atccgttcagatttccctgaatctccgaaagacaaactccacgactcggcaaacctaagc
attctgtcgggaggaaccccaaaatgttgccttgacctttcgaatcttagcagtggagag
atgtctgcctctccgcttactacttctgctgaccttgaggacaatggttccttggattca
tctggacctctggatagacagttaactggcaaggattttcaccaggaccttatgaaaggt
atcccagtacagcttctttgtagtactccgaatgctatgaatcatggccacagaaagaag
attgcaaagcgtagcacatctgcacataaagaaaatataaacaccagtttaaaggcattg
gaatgggaggcacctaggaccccaaggtttcgaaaaatgcctggaggtcctctgacttct
cctctgtgtgagctggaaatgaagcatctgggcagtcccattactacggttcctaagctg
agtcaaaatgtaaagctagaagaccaagaaaggatttcagaagacccaatggagtgttcc
ctgggagaccaggacgccaagggcttaagtctaaggaagatggtcccactctgtgacatg
aacgccattcagatggaggaggaagagtctggctcagagcttctgattggtgatttctca
aaggtgtgtgtgctgccaacggtgccagggaaacacccggatctgaagtatatcagccca
gacacagtggctgctttgctgtctggaaagttccagagtgtgatcgagaggttttatatc
attgattgccgctatccgtatgagtacctgggaggccacatcctgggagccttaaacctg
cacagtcagaaggaactgcatgagttctttctgaggaagcctgttgttcctctggatatc
cagaaaagagtcatcattgtgttcctctgtgaattctcctccgagagaggccctcgaatg
tgccgttctctgagagaaaaagacagggctctgaaccagtatccggcattatattaccct
gagctatatatcctcaaagggggctacagagatttctttccagagtatatggagctgtgt
gacccacagagctactgtcccatgcttcaccaggaccaccaggctgagctgctgagctgg
cgaagccagagcaaggcccaggaaggggagcggcagctgcagggacagattgccctcctg
gtgaagggtgcgagcccacaatag

DBGET integrated database retrieval system