KEGG   Mus musculus (mouse): 12532
Entry
12532             CDS       T01002                                 

Gene name
Cdc25c, Cdc25
Definition
(RefSeq) cell division cycle 25C
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
mmu05170  Human immunodeficiency virus 1 infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12532 (Cdc25c)
   04114 Oocyte meiosis
    12532 (Cdc25c)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12532 (Cdc25c)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12532 (Cdc25c)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12532 (Cdc25c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    12532 (Cdc25c)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12532 (Cdc25c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     12532 (Cdc25c)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12532 (Cdc25c)
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    12532 (Cdc25c)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    12532 (Cdc25c)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 12532
NCBI-ProteinID: NP_033990
MGI: 88350
Ensembl: ENSMUSG00000044201
UniProt: P48967 Q3UR74
Position
18 B1; 18 18.71 cM
AA seq 447 aa
MSTGPIPPASEEGSFVSAPSFRSKQRKILHLLLERNTSFTIRSDFPESPKDKLHDSANLS
ILSGGTPKCCLDLSNLSSGEMSASPLTTSADLEDNGSLDSSGPLDRQLTGKDFHQDLMKG
IPVQLLCSTPNAMNHGHRKKIAKRSTSAHKENINTSLKALEWEAPRTPRFRKMPGGPLTS
PLCELEMKHLGSPITTVPKLSQNVKLEDQERISEDPMECSLGDQDAKGLSLRKMVPLCDM
NAIQMEEEESGSELLIGDFSKVCVLPTVPGKHPDLKYISPDTVAALLSGKFQSVIERFYI
IDCRYPYEYLGGHILGALNLHSQKELHEFFLRKPVVPLDIQKRVIIVFLCEFSSERGPRM
CRSLREKDRALNQYPALYYPELYILKGGYRDFFPEYMELCDPQSYCPMLHQDHQAELLSW
RSQSKAQEGERQLQGQIALLVKGASPQ
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtctacaggacctatcccacctgcaagtgaagagggaagttttgtttcagcacccagt
tttaggtccaaacaaaggaagatattacacctacttttggagagaaacacttcttttacc
atccgttcagatttccctgaatctccgaaagacaaactccacgactcggcaaacctaagc
attctgtcgggaggaaccccaaaatgttgccttgacctttcgaatcttagcagtggagag
atgtctgcctctccgcttactacttctgctgaccttgaggacaatggttccttggattca
tctggacctctggatagacagttaactggcaaggattttcaccaggaccttatgaaaggt
atcccagtacagcttctttgtagtactccgaatgctatgaatcatggccacagaaagaag
attgcaaagcgtagcacatctgcacataaagaaaatataaacaccagtttaaaggcattg
gaatgggaggcacctaggaccccaaggtttcgaaaaatgcctggaggtcctctgacttct
cctctgtgtgagctggaaatgaagcatctgggcagtcccattactacggttcctaagctg
agtcaaaatgtaaagctagaagaccaagaaaggatttcagaagacccaatggagtgttcc
ctgggagaccaggacgccaagggcttaagtctaaggaagatggtcccactctgtgacatg
aacgccattcagatggaggaggaagagtctggctcagagcttctgattggtgatttctca
aaggtgtgtgtgctgccaacggtgccagggaaacacccggatctgaagtatatcagccca
gacacagtggctgctttgctgtctggaaagttccagagtgtgatcgagaggttttatatc
attgattgccgctatccgtatgagtacctgggaggccacatcctgggagccttaaacctg
cacagtcagaaggaactgcatgagttctttctgaggaagcctgttgttcctctggatatc
cagaaaagagtcatcattgtgttcctctgtgaattctcctccgagagaggccctcgaatg
tgccgttctctgagagaaaaagacagggctctgaaccagtatccggcattatattaccct
gagctatatatcctcaaagggggctacagagatttctttccagagtatatggagctgtgt
gacccacagagctactgtcccatgcttcaccaggaccaccaggctgagctgctgagctgg
cgaagccagagcaaggcccaggaaggggagcggcagctgcagggacagattgccctcctg
gtgaagggtgcgagcccacaatag

DBGET integrated database retrieval system