KEGG   Mus musculus (mouse): 12532Help
Entry
12532             CDS       T01002                                 

Gene name
Cdc25c, Cdc25
Definition
(RefSeq) cell division cycle 25C
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
mmu05206  MicroRNAs in cancer
Module
mmu_M00691  DNA damage-induced cell cycle checkpoints
mmu_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12532 (Cdc25c)
   04114 Oocyte meiosis
    12532 (Cdc25c)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12532 (Cdc25c)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    12532 (Cdc25c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     12532 (Cdc25c)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12532 (Cdc25c)
 Protein Tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    12532 (Cdc25c)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    12532 (Cdc25c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-GeneID: 12532
NCBI-ProteinID: NP_033990
MGI: 88350
Ensembl: ENSMUSG00000044201
UniProt: P48967 Q3UR74
Position
18 B1; 18 18.71 cM
AA seq 447 aa AA seqDB search
MSTGPIPPASEEGSFVSAPSFRSKQRKILHLLLERNTSFTIRSDFPESPKDKLHDSANLS
ILSGGTPKCCLDLSNLSSGEMSASPLTTSADLEDNGSLDSSGPLDRQLTGKDFHQDLMKG
IPVQLLCSTPNAMNHGHRKKIAKRSTSAHKENINTSLKALEWEAPRTPRFRKMPGGPLTS
PLCELEMKHLGSPITTVPKLSQNVKLEDQERISEDPMECSLGDQDAKGLSLRKMVPLCDM
NAIQMEEEESGSELLIGDFSKVCVLPTVPGKHPDLKYISPDTVAALLSGKFQSVIERFYI
IDCRYPYEYLGGHILGALNLHSQKELHEFFLRKPVVPLDIQKRVIIVFLCEFSSERGPRM
CRSLREKDRALNQYPALYYPELYILKGGYRDFFPEYMELCDPQSYCPMLHQDHQAELLSW
RSQSKAQEGERQLQGQIALLVKGASPQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaggacctatcccacctgcaagtgaagagggaagttttgtttcagcacccagt
tttaggtccaaacaaaggaagatattacacctacttttggagagaaacacttcttttacc
atccgttcagatttccctgaatctccgaaagacaaactccacgactcggcaaacctaagc
attctgtcgggaggaaccccaaaatgttgccttgacctttcgaatcttagcagtggagag
atgtctgcctctccgcttactacttctgctgaccttgaggacaatggttccttggattca
tctggacctctggatagacagttaactggcaaggattttcaccaggaccttatgaaaggt
atcccagtacagcttctttgtagtactccgaatgctatgaatcatggccacagaaagaag
attgcaaagcgtagcacatctgcacataaagaaaatataaacaccagtttaaaggcattg
gaatgggaggcacctaggaccccaaggtttcgaaaaatgcctggaggtcctctgacttct
cctctgtgtgagctggaaatgaagcatctgggcagtcccattactacggttcctaagctg
agtcaaaatgtaaagctagaagaccaagaaaggatttcagaagacccaatggagtgttcc
ctgggagaccaggacgccaagggcttaagtctaaggaagatggtcccactctgtgacatg
aacgccattcagatggaggaggaagagtctggctcagagcttctgattggtgatttctca
aaggtgtgtgtgctgccaacggtgccagggaaacacccggatctgaagtatatcagccca
gacacagtggctgctttgctgtctggaaagttccagagtgtgatcgagaggttttatatc
attgattgccgctatccgtatgagtacctgggaggccacatcctgggagccttaaacctg
cacagtcagaaggaactgcatgagttctttctgaggaagcctgttgttcctctggatatc
cagaaaagagtcatcattgtgttcctctgtgaattctcctccgagagaggccctcgaatg
tgccgttctctgagagaaaaagacagggctctgaaccagtatccggcattatattaccct
gagctatatatcctcaaagggggctacagagatttctttccagagtatatggagctgtgt
gacccacagagctactgtcccatgcttcaccaggaccaccaggctgagctgctgagctgg
cgaagccagagcaaggcccaggaaggggagcggcagctgcagggacagattgccctcctg
gtgaagggtgcgagcccacaatag

DBGET integrated database retrieval system