KEGG   Mus musculus (mouse): 12534Help
Entry
12534             CDS       T01002                                 

Gene name
Cdk1, Cdc2, Cdc2a, p34<CDC2>
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04218  Cellular senescence
mmu04540  Gap junction
mmu04914  Progesterone-mediated oocyte maturation
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12534 (Cdk1)
   04114 Oocyte meiosis
    12534 (Cdk1)
   04115 p53 signaling pathway
    12534 (Cdk1)
   04218 Cellular senescence
    12534 (Cdk1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    12534 (Cdk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12534 (Cdk1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12534 (Cdk1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12534 (Cdk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12534 (Cdk1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12534 (Cdk1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12534 (Cdk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12534 (Cdk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12534 (Cdk1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     12534 (Cdk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   12534 (Cdk1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    12534 (Cdk1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    12534 (Cdk1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12534 (Cdk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo APH Choline_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 12534
NCBI-ProteinID: NP_031685
MGI: 88351
Ensembl: ENSMUSG00000019942
Vega: OTTMUSG00000031247
UniProt: P11440
Position
10 B5.3; 10 36.07 cM
AA seq 297 aa AA seqDB search
MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaagactatatcaaaatagagaaaattggagaaggtacttacggtgtggtgtataag
ggtagacacagagtcactggccagatagtggccatgaagaagatcagacttgaaagcgag
gaagaaggagtgcccagtactgcaattcgggaaatctctctattaaaagaacttcgacat
ccaaatatagtcagcctgcaggatgtgctcatgcaggactccaggctgtatctcatcttt
gagttcctgtccatggacctcaagaagtacctggactccatccctcctgggcagttcatg
gattcttcactcgttaagagttacttacaccaaatcctccagggaattgtgttttgccac
tcccggcgagttcttcacagagacttgaaacctcaaaatctattgattgatgacaaagga
acaatcaaactggctgatttcggccttgccagagcgtttggaataccgatacgagtgtac
acacacgaggtagtgacgctgtggtaccgatctccagaagtgttgctgggctcggctcgt
tactccactccggttgacatctggagtatagggaccatatttgcagaactggccaccaag
aagccgcttttccacggcgactcagagattgaccagctcttcaggatcttcagagctctg
ggcactcctaacaacgaagtgtggccagaagtcgagtccctgcaggactacaagaacacc
tttcccaagtggaagccggggagcctcgcatcccacgtcaagaacctggacgagaacggc
ttggatttgctctcaaaaatgctagtctatgatcctgccaaacgaatctctggcaaaatg
gccctgaagcacccgtactttgatgacttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system