KEGG   Mus musculus (house mouse): 12558
Entry
12558             CDS       T01002                                 
Symbol
Cdh2, CDHN, N-CAD, Ncad
Name
(RefSeq) cadherin 2
  KO
K06736  cadherin 2, type 1, N-cadherin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12558 (Cdh2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    12558 (Cdh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12558 (Cdh2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    12558 (Cdh2)
   04090 CD molecules [BR:mmu04090]
    12558 (Cdh2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    12558 (Cdh2)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   12558 (Cdh2)
CD molecules [BR:mmu04090]
 Proteins
  12558 (Cdh2)
SSDB
Motif
Pfam: Cadherin Cadherin_pro CADH_Y-type_LIR Cadherin_3 Stevor
Other DBs
NCBI-GeneID: 12558
NCBI-ProteinID: NP_031690
MGI: 88355
Ensembl: ENSMUSG00000024304
UniProt: P15116 Q3UIC2 Q8BSI9
Structure
Position
18:complement(16721934..16942303)
AA seq 906 aa
MCRIAGAPRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLPKDVHEGQPLLNVKF
SNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPLTAEQAKFLIYAQDKETQEKWQVAVN
LSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVIVANLTVTDKDQPHTPAWNAAY
RISGGDPTGRFAILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTLTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPEPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTINRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGDQDYDYLNDWGPRFKKLADM
YGGGDD
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgtgccggatagcgggagcgccgcggaccctgctgccgcttctggcggccttgcttcag
gcgtctgtggaggcttctggtgaaattgcattatgcaagactggatttcctgaagatgtt
tacagcgcagtcttaccgaaggatgtgcacgaaggacagccccttctcaatgtgaaattc
agcaactgcaatagaaaaaggaaagttcagtatgaaagcagcgagccagcagatttcaag
gtggacgaggacggcacggtgtatgctgtgagaagcttccctctcactgcagagcaggca
aagttcctgatatatgcccaagacaaagaaacccaggaaaagtggcaggtagctgtaaac
ctgagccgggagccaaccctgactgaggagcctatgaaggaaccacatgaaattgaagaa
atagtattccctagacaacttgccaagcacagtggagctctacaaaggcagaagagagac
tgggtcatcccgccaatcaacttgccagaaaactccagaggaccctttcctcaagagctt
gtcagaatcaggtctgatagagataaaaacctttccctgagatacagcgtcactgggcca
ggagctgaccagcctccaacgggcatcttcattatcaaccccatctcaggacagctgtca
gtcacaaagcctctggatcgagagctgatagcccggtttcacttgagagcacatgcagtg
gacatcaatggcaatcaagtggagaaccccattgacattgtcatcaatgttattgacatg
aatgataacagacctgagtttctgcaccaggtttggaatgggtctgttccagagggatca
aagcctgggacgtatgtgatgacggtcactgccattgatgcggatgatccaaatgccctg
aatggaatgctgcggtacaggatcctgtcccaggcgcccagcacaccttcacccaacatg
tttacaatcaacaatgagactggggacatcatcactgtggcagctggtctggatcgagag
aaagtgcaacagtatacgttaataattcaagccacagacatggaaggcaatcccacttat
ggcctttcaaacacagccacagccgtcatcacggtgacagatgtcaatgacaatcctcca
gagtttactgccatgactttctacggagaagtccctgagaacagggtggacgtcattgta
gccaacctaactgtcacggacaaagatcagccccacacgccggcctggaatgcggcatac
agaatcagtggtggagaccctacaggaaggtttgccatcctgacagaccccaacagcaat
gatgggctagtcacagtggtaaaaccaattgactttgaaacgaataggatgtttgtcctt
actgttgctgcagaaaaccaagtgccattagctaaaggcattcagcacccacctcagtcg
acagccactgtgtctgtgacagttattgatgtcaatgaaaatccttattttgccccaaat
cctaaaatcattcgccaagaggaaggcctccacgcaggtaccatgctgaccacgctcact
gctcaggaccccgatcgatatatgcaacagaatatcagatacacaaaattgtctgatcct
gccaactggctgaaaatagaccccgtgaatgggcagatcactactattgccgttttggac
agagaatcgccaaatgtaaaaaacaacatctataatgctaccttccttgcttctgacaat
ggaatcccgcctatgagtgggacaggaacactgcaaatctatttacttgatatcaatgac
aacgcccctcaggtgttacctcaagaggcggagacctgtgaaactccagaacccaactca
attaacatcacagcacttgattatgacatagacccaaacgccgggccgttcgcgtttgat
cttcccttatctccagtgactattaaaagaaactggaccatcaaccggcttaatggtgat
tttgctcagctcaatttaaagataaaatttttggaagctggtatctatgaagttcccatc
attatcacagattcagggaatccccccaagtccaacatttccatcctgcgtgtgaaagtt
tgtcagtgtgactccaatggagactgcacggacgtggacaggatcgtgggtgcagggctt
ggcacgggcgccatcatcgctatccttctgtgtatcatcatcctgctgatccttgttctc
atgtttgtggtatggatgaaacggcgggataaagagcgccaagccaagcagcttttaatt
gacccagaagatgatgtaagagataatatattgaaatatgatgaagaaggtggaggagaa
gaagaccaggactatgacttgagccagctccagcaaccagatactgtggagcctgatgcc
atcaagcccgtgggaatcagacggctagacgagaggcctatccatgctgagccacagtac
ccagtccgatccgcagccccacaccctggggatattggggacttcattaatgagggcctt
aaagctgctgacaacgaccccacggcgccaccgtatgactccctcttagtctttgactac
gagggcagcggctccacggctggctccttgagctccctcaactcctccagtagcggtggg
gaccaggactatgactacctgaatgactggggaccccgcttcaagaaactggcggacatg
tacggcggtggtgacgactga

DBGET integrated database retrieval system