KEGG   Mus musculus (mouse): 12562
Entry
12562             CDS       T01002                                 

Gene name
Cdh5, 7B4, AA408225, Cd144, VE, VE-C, VE-Cad, VECD, VEcad, Vec
Definition
(RefSeq) cadherin 5
  KO
K06533  cadherin 5, type 2, VE-cadherin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04670  Leukocyte transendothelial migration
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12562 (Cdh5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12562 (Cdh5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12562 (Cdh5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    12562 (Cdh5)
   04090 CD molecules [BR:mmu04090]
    12562 (Cdh5)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   12562 (Cdh5)
CD molecules [BR:mmu04090]
 Proteins
  12562 (Cdh5)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_3 Cadherin_2 Peptidase_M99_C Stevor
Other DBs
NCBI-GeneID: 12562
NCBI-ProteinID: NP_033998
MGI: 105057
Ensembl: ENSMUSG00000031871
Vega: OTTMUSG00000061476
UniProt: P55284
Position
8 D3; 8 53.04 cM
AA seq 784 aa
MQRLTELATALGAFLGLLAVAAMAGPNFPQIDTPNMLPAHHRQKRDWIWNQMHIDEEKNE
SLPHYVGKIKSNVNRQNAKYVLQGEFAGKIFGVDANTGNVLAYERLDREKVSEYFLTALI
VDKNTNKNLEQPSSFTVKVHDINDNWPVFSHQVFNASVPEMSAIGTSVIRVTAVDADDPT
VAGHATVLYQIVKGNEYFSIDNSGLIFTKIKNLDREKQAEYKIVVETQDALGLRGESGTA
TVMIRLEDINDNFPVFTQSTYTFSVPEDIRVGKPLGFLTVVDPDEPQNRMTKYSIMQGEY
RDTFTIETDPKRNEGIIKPTKSLDYEVIQQYTFYIEATDPTIRYEYLSSTSGKNKAMVTI
NVLDVDEPPVFQRHFYHFKLPENQKKPLIGTVVAKDPDKAQRSIGYSIRKTSDRGQFFRI
TKQGNIYNEKELDRETYAWYNLTVEANELDSRGNPVGKESIVQVYIEVLDENDNPPEFAQ
PYEPKVCENAAQGKLVVQISATDKDVVPVNPKFKFALKNEDSNFTLINNHDNTANITVKY
GQFNREHAKFHYLPVLISDNGVPSLTGTSTLTVGVCKCNEQGEFTFCEEMAAQAGVSIQA
LVAIFLCILTITVITLLIILRRRIRKQAHAHSKSALEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRGGSTKPLRSTMDARPAVYTQVQKPPRLAPGLHGGPREMATMIDVKKEEADNDG
GGPPYDTLHIYGYEGAESIAESLSSLSTNSSDSDIDYDFLNDWGPRFKMLAELYGSDPQE
ELII
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcagaggctcacagagctggccactgctttgggagccttcctgggcctcctggcagtg
gcagcaatggcaggccctaactttccccagatagacacccccaacatgctacctgcccac
catcgccaaaagagagactggatttggaatcaaatgcacatcgatgaagagaaaaatgaa
tcgctgccccactatgtgggaaagatcaagtccaacgtgaaccgccagaatgctaagtat
gtgctccaaggagagtttgctggcaagatcttcggggtcgatgctaacacagggaatgtg
cttgcctatgagaggctagaccgggagaaagtctctgagtacttccttactgccctcatt
gtggacaagaacaccaacaaaaacctggaacaaccttccagcttcactgtcaaggtgcat
gatataaatgacaattggcctgtgttttcgcaccaggtattcaacgcatctgtgccagag
atgtcagctatagggacctctgtcatccgtgtgacagcagtggatgcagatgaccccact
gtggccggccacgccactgtcttgtaccaaatcgtgaaaggaaatgagtatttcagcatt
gataattctggactcattttcacaaagatcaaaaacttggaccgagagaaacaggctgaa
tacaagatcgtggtggaaacacaagatgccctgggtctgcggggagagtcaggcacagcc
actgtgatgatcagactggaggacatcaatgacaacttccccgtctttactcaatccaca
tacacattttcggtgcctgaagacatccgagtgggcaagcccttgggctttctgactgtt
gtggacccagatgagcctcagaaccggatgaccaagtacagcatcatgcagggcgagtac
agggacaccttcaccattgagacagaccccaaacgtaacgagggtatcatcaaacccacg
aagtccctggactatgaagtcatccagcagtacacattctacattgaggccacagacccc
actatccgatacgaatacctgagcagcacttcaggcaaaaacaaagccatggtcaccatc
aacgtcctagatgtggatgagccccctgtcttccagcgacacttctaccacttcaagctg
ccagaaaaccagaagaaaccgctgatcggcactgtggtggccaaagaccctgacaaggct
cagcgcagcatcgggtactccatccgcaagaccagtgacagaggccaattcttccgaata
accaagcagggaaacatctataacgagaaagaactggacagagaaacctacgcctggtat
aacctgactgtggaggccaacgaactggattctcggggtaaccctgtagggaaagagtcc
attgtgcaggtttacattgaagtcttggatgagaatgacaaccctccggaatttgcccag
ccctacgaacctaaagtgtgtgagaatgctgcccagggcaagctggtagtacagatctct
gcaacagacaaggatgtggtgccagtaaacccaaagttcaagtttgccctgaagaacgag
gacagcaacttcaccctcataaacaaccatgacaacaccgccaacatcacggtcaagtat
gggcagtttaatcgggagcatgccaagttccactacctgcccgtgctcatctcagacaac
ggggtgcccagcctgactggaaccagcacgctaaccgtgggtgtgtgcaagtgcaacgag
cagggcgagttcaccttctgtgaggagatggcagcccaggcgggtgtcagcatccaggcg
ctggtggccatcttcctctgcatcctcaccatcacagtgattaccttgctgatcatcctg
cggaggcggatccggaagcaggcgcatgctcatagcaagagtgcgctggagattcacgag
cagttggtcacttacgatgaggagggcggtggtgagatggacaccaccagctatgatgtg
tcagtgcttaattctgtgcgcggtggctccactaagcccctgcgctccacgatggacgcc
cggccggcagtgtacacgcaggtgcagaagccgccgcgcctggcgcctggactgcacgga
gggcccagggagatggccaccatgatcgacgtgaagaaagaagaggcagacaatgacggc
ggtggccccccatacgacacactgcacatctacggctacgagggcgcagagtccatcgca
gagtccctcagttccctgagcaccaattcctccgactctgacatcgattatgacttcctc
aacgactggggacccaggttcaagatgctggctgagctgtacggctcagatccccaggag
gaactcatcatctag

DBGET integrated database retrieval system