KEGG   Mus musculus (mouse): 12568
Entry
12568             CDS       T01002                                 

Gene name
Cdk5, AW048668, Crk, Crk6
Definition
(RefSeq) cyclin-dependent kinase 5
  KO
K02090  cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    12568 (Cdk5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12568 (Cdk5)
   05022 Pathways of neurodegeneration - multiple diseases
    12568 (Cdk5)
  09165 Substance dependence
   05030 Cocaine addiction
    12568 (Cdk5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12568 (Cdk5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12568 (Cdk5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12568 (Cdk5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   12568 (Cdk5)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    12568 (Cdk5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase Seadorna_VP7 APH Kinase-like
Other DBs
NCBI-GeneID: 12568
NCBI-ProteinID: NP_031694
MGI: 101765
Ensembl: ENSMUSG00000028969
Vega: OTTMUSG00000053656
UniProt: P49615 Q543F6
Position
5 A3; 5 11.73 cM
AA seq 292 aa
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcagaaatacgagaaactggagaagattggggaaggcacctatggaactgtgttcaag
gctaaaaaccgggaaactcatgagattgtggctctgaagcgtgtcaggctggatgatgac
gatgagggtgtgccaagttcagccctccgggagatctgtctactcaaagaactgaagcac
aaaaacattgtcaggcttcatgatgtcctgcatagtgacaagaagctgacactggttttt
gagttctgtgatcaggacctgaagaaatatttcgacagctgcaatggtgacctggaccct
gagattgtgaagtcattcctcttccagctgctgaaaggcctgggattctgtcacagccgc
aacgtgctacatagggacctgaagccccagaacctgctcataaacaggaatggggagttg
aaattggctgattttggcctggcccgagcctttggtatccccgtccgctgctactctgct
gaggtggtcacgctgtggtaccgcccaccggatgtcctctttggggccaagctgtactcc
acgtccatcgacatgtggtcagccggctgcatctttgcagagctggctaatgcaggacga
cctctcttccctggcaatgatgtggatgaccagctgaagaggatcttccgactgctaggg
acaccgactgaggaacaatggcctgccatgaccaagctgccagactataagccctaccca
atgtacccagctacaacatccttggtgaacgtcgtgcccaagctcaatgccacggggagg
gacctgttgcagaacctattgaagtgtaaccctgtgcagcgcatctcagcagaggaggcc
ttgcagcacccctacttctctgacttctgtcccccatag

DBGET integrated database retrieval system